SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CRE26052 from Caenorhabditis remanei

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CRE26052
Domain Number - Region: 313-354
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000166
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 
Domain Number - Region: 140-271
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.00241
Family Apolipophorin-III 0.00087
Further Details:      
 
Domain Number - Region: 277-329
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0205
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CRE26052   Protein: RP48437   Gene: WBGene00054491
Sequence length 410
Comment RP48437 WBGene00054491 status:Predicted
Sequence
MTEESRKGHGDSQESNDVKEDENEATSTRLIDRFARNSRSRGGQRDFIEEWSHRNLLDGR
KDHSKIELYDDIFSQGRTSEGRIEGPKSRMSQDSILENEVVTDEDIESIVYDETTLLETE
PEITSESLIPIGESDVRASRREDDQSLNNSKDRNEMMAEAQKQEDVKEAVNAFMKSIDDR
IESSNSKSSKKLKEAKKKLEEAVDQYKAGESSEAEAKFLRNIIRYQYAAQQVLTETIDEE
LEDQSKLIDEVVATSEELAKKNEELTQKLKEMRAGEQEKDHPACFFCESTKHSAVVCYQF
RDYEERTNMLIAEDKCLLCFQKGHKKTECADLARYESCKKCKQEKHHVSICPKYATKERT
EMKQARGPSQKKEDEQGDMSGRHKEEWKELDGPKQSSSEAKKQRQPILPP
Download sequence
Identical sequences E3LRF8
CRE26052 XP_003113860.1.11157 31234.CRE26052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]