SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|472323594|ref|YP_007655840.1| from Pseudomonas denitrificans ATCC 13867

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472323594|ref|YP_007655840.1|
Domain Number 1 Region: 23-200
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.4e-27
Family Clp protease, ClpP subunit 0.048
Further Details:      
 
Domain Number 2 Region: 373-439
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000196
Family NfeD domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|472323594|ref|YP_007655840.1|
Sequence length 447
Comment membrane-bound protease [Pseudomonas denitrificans ATCC 13867]
Sequence
MSRLLRLFACFLLLGAGGVLAAPTVVVLDLDGAIGPASADYVVRGISRAADEGAALVVLR
MDTPGGLDSAMRSIVKAILTSPVPVAGYVAPGGARAASAGTYILYACHVAAMAPGTNLGA
ATPIRIGMPDAEKPQDKSADKPDTGTDTLERKQINDAAAYIRGLAQLRGRNAEWAERAVR
EAVSLAADEALKQKVVDVVAPDIPMLLTMIDGRSVSVDGRDVRLEVAGAALLQREPDWRT
RLLAVITDPSVALILMMIGIYGLIFELANPGMALPGVLGAICLLLGLYALQMLPVNYAGV
ALILLGLGFMVGEAFMPSFGALGLGGIVAFVVGSLILIDTDAPGFGIPLALVITLATVSA
LFIGGILGVALKARRRAVVSGPVGLLGSLATIQWVADDDPCAGWVVLQGEQWQVHANRPL
HCGQRVRVMARNGLSLEVAANDDSGGV
Download sequence
Identical sequences M4XAB4
WP_015475187.1.1924 gi|472323594|ref|YP_007655840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]