SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|472326487|ref|YP_007658733.1| from Pseudomonas denitrificans ATCC 13867

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|472326487|ref|YP_007658733.1|
Domain Number 1 Region: 2-364
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.68e-113
Family FMN-linked oxidoreductases 0.00000000218
Further Details:      
 
Domain Number 2 Region: 335-523
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 6.94e-43
Family N-terminal domain of adrenodoxin reductase-like 0.00000777
Further Details:      
 
Domain Number 3 Region: 464-522,560-655
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.93e-19
Family C-terminal domain of adrenodoxin reductase-like 0.0000644
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|472326487|ref|YP_007658733.1|
Sequence length 677
Comment 2,4-dienoyl-CoA reductase [Pseudomonas denitrificans ATCC 13867]
Sequence
MTAPYPHLLAPLDLGFTTLRNRTLMGSMHTGLEEKPQGFERMAAYFAERARGGVGLMVTG
GIGPNEEGGVYSGAAKLSTAEEAEKHKIVTQAVHEAGGKICMQILHAGRYAYSPKSVAPS
AIQAPINPFKPRELDEEGIEKQIADFVNCSSLAQVAGYDGVEIMGSEGYFINQFLVAHTN
QRTDRWGGSYENRMRLPVEIVRRVREAVGPNFIIIYRLSMLDLVEGGSTWDEIVLLAKAI
EQAGATLINTGIGWHEARIPTIATKVPRAAFTKVTAKLRGEIGIPLITTNRINTPEIAEQ
VLAEGDADMVSMARPFLADPDFVNKAAEGRSDEINTCIGCNQACLDHTFGGKLTSCLVNP
RACHETELNYIPTTHVKKIAVVGAGPAGLSAATVAAERGHEVTLFDAAGEIGGQFNVAKR
VPGKEEFYETLRYFKRKVETSGVQLRLNTRVSVDDLARGGFDEIILATGIVPRTPAIPGI
DNAKVISYLDAILERKPVGSRVAVIGAGGIGFDVSEYVTHSGESTSLDRHAFWREWGIDE
NLEARGGVAGIQAHPHAAARQVFLLQRKKSKVGDGLGKTTGWIHRTGLKNKQVQMLNSVE
YLKVDNDGLHISVAGGEPQVLPVDTVVVCAGQDPLRELHDGLVAAGQSVHLIGGADVAAE
LDAKRAINQGSRLAAEL
Download sequence
Identical sequences M4WYE7
gi|472326487|ref|YP_007658733.1| WP_015478046.1.1924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]