SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|34557304|ref|NP_907119.1| from Wolinella succinogenes DSM 1740

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|34557304|ref|NP_907119.1|
Domain Number 1 Region: 49-365
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 1.44e-53
Family Nitrous oxide reductase, N-terminal domain 0.0000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|34557304|ref|NP_907119.1|
Sequence length 410
Comment nitrous oxide reductase subunit [Wolinella succinogenes DSM 1740]
Sequence
MQRLLKQSLVVTASLLALGTASLASSDLQTIMKERKLTEKDVLAAAKTYQPSGRKDEFVV
FSSGGQSGQILVYGVPSMRIYKYIGVFTPEPWQGYGFDDDSKKVLRQGDIRGREINWGDT
HHPNFTEKNGEYVGDYLFINDKANPRIAVVNLHDFETTQIVVNPIMKSEHGGSFVTPNTE
YVIEASQYAAPLDHQYHPIEEYEAVFRGAVTLWKFDYAKGKIDEKASFSLEFPPYMQDLS
DAGKGESFGWAFTNSFNSEMYTGGIEKGLPPFEAGMSRNDTDYMHVYNWQMLEKLAQDPK
NYKIYHGHRVISIEAAVKAGALFLIPEPKSPHGVDVSPDGRYIVVGGKLDTHASVYDFRK
IKQLIDKKEFIGADPYGIPILDMKKTLHGQVELYCHHLSRQLFENSSSSL
Download sequence
Identical sequences Q7M9H5
gi|34557304|ref|NP_907119.1| 273121.WS0914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]