SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|128964|estExt_fgenesh1_pm.C_100118 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|128964|estExt_fgenesh1_pm.C_100118
Domain Number 1 Region: 155-392
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.98e-63
Family G proteins 0.00000141
Further Details:      
 
Domain Number 2 Region: 377-469
Classification Level Classification E-value
Superfamily Translation proteins 2.91e-20
Family Elongation factors 0.0013
Further Details:      
 
Domain Number 3 Region: 489-563
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.000000000000504
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|128964|estExt_fgenesh1_pm.C_100118
Sequence length 565
Sequence
MAPPTTYDDDDFVDQYDDIEEEDEMSAEDKVAMQQGTAEVQKALGTEASKVTVAQIQEAL
WHYYYDIDKSVTYLTKTFIAPAPKAAPKPAPKKAPEAGKKTPATPKTTKKSQKNEEAAKE
GGLASSVSSLKINDGPPPNSKGLDVIKEFEQNASKRNASFVVVGHVDAGKSTLMGRLLLE
LKLVEERTVDKYRRQGEKIGKQSFALAWVMDQRSEERDRGVTIDIATNHFETESTKFTIL
DAPGHRDFVPNMIAGASQADFAILVIDANTGAYEKGLKGQTREHVLLLRSLGVQQLIVAV
NKLDMVGWSQDRFQEILEEVSGFLTGLGFQDKHVTFIPISGLNGDNIVKRTEDAAGLWYK
GPTLIEGLEASGPSTARALKKPFRMAISEIFRSQQGTTTLAGRIDSGTIQIGDPVLVQPS
GESAYIKSIMLDTEAKDWAVAGQNVSVALTNIDPIHIKIGDIICHTTDPIAVGDTFTMKA
MAFEHLMPMPVDLHRGRLHAAGQIQSIAATLDKATGEVVKKKPKVVQPGGVARILIKLEA
KVPLEAGQRVVIRSGGETIAAGLLE
Download sequence
Identical sequences jgi|Triat1|128964|estExt_fgenesh1_pm.C_100118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]