SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|131227|estExt_fgenesh1_pg.C_30052 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|131227|estExt_fgenesh1_pg.C_30052
Domain Number 1 Region: 39-111
Classification Level Classification E-value
Superfamily Translation proteins 1.06e-18
Family Gar1-like SnoRNP 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|131227|estExt_fgenesh1_pg.C_30052
Sequence length 213
Sequence
MSFRGGGRGGGRGGAGGFRGGRGGGFQQRDMGPPAQVLEMGKFIHACEGEMVCESINPKV
PHFNAQIFLENKTAVGKVDEVLGPINQVFFTIKPSEGIQAASFKEGDKFYIAPEKLLPLE
KFLPKPKPPPGAPKPKRAGGGGRGGPRGGGRGGFSRGGRGGAGGGFGGRGGRGGSGGFSR
GGGRGGPRGGSGGFSRGGAGGRGRGGFSRGGSW
Download sequence
Identical sequences G9NYM1
XP_013941992.1.20613 jgi|Triat1|131227|estExt_fgenesh1_pg.C_30052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]