SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|138079|estExt_Genewise1.C_31112 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|138079|estExt_Genewise1.C_31112
Domain Number 1 Region: 279-521
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.04e-58
Family G proteins 0.0000000764
Further Details:      
 
Domain Number 2 Region: 608-715
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.67e-28
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00027
Further Details:      
 
Domain Number 3 Region: 511-602
Classification Level Classification E-value
Superfamily Translation proteins 6.65e-20
Family Elongation factors 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|138079|estExt_Genewise1.C_31112
Sequence length 720
Sequence
MSNLNSWEDDPAAQDENLAQQAQQQLNMNPAAAQGGFRPGASSFQPGAASFQPGQTYGGG
AYGQYQQQYYQQPQGFYPQYGAGQGLDQYNQQYQNYGGGYNQGYNQNFGQGYPQYGQQQG
QQGQRNQQQQQFAAPAQNNAAQAAPVKSLPVEKPAASAPKPVVTTEGGAKVLSIGGDAKP
KAKVLSIGAPTASSPSPAKDEAKTEPSNAPDAGKKVTAAKAIEKTGEKAGKAAASGKSSG
RTSPDPSSGRSSPSAAEKKTQREVDAVLKAQAADVDDDTLKEIYGKEHVNIIFIGHVDAG
KSTLGGSILWTTGMVDERTMDKYKKEAKDLGRESWYLSWVMDLTKEERTKGKTVEVGRGF
FETEKRRYSILDAPGHKTYVPSMIGGASQADVGILVISARKGEYETGFERGGQTREHAML
AKTQGVNKLIVAINKMDDPTVEWSEERYKECTTKLQQFLKGTGYNLKTDVYFMPVAAQQS
LNIKDRLPEGVAPWWKGPSLLEYLDGMQALERKVNAPFMMPVNAKYRDLGTMVDGKIEAG
VIKKGMSLVMMPRKQSVETAAIYGEQEEEQPILQCGDQVRLRLKGIEEEDILPGFVLCSP
KRLVHCVAEFEAQIKVLDLKSILTSGFNCVLHVHAAIEEVTFASLLHKLQKGTGRKSKVP
PTHAKKGDSIIARLQVTGGAGMVCVEKFEDYPQMGRFTLRDQGQTIAIGKITKLITSDDQ
Download sequence
Identical sequences G9P041
XP_013942324.1.20613 jgi|Triat1|138079|estExt_Genewise1.C_31112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]