SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|142339|estExt_Genewise1.C_100060 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|142339|estExt_Genewise1.C_100060
Domain Number 1 Region: 427-726
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.28e-59
Family G proteins 0.0000044
Further Details:      
 
Domain Number 2 Region: 761-888
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 4.97e-35
Family Initiation factor IF2/eIF5b, domain 3 0.00018
Further Details:      
 
Domain Number 3 Region: 894-1027
Classification Level Classification E-value
Superfamily Translation proteins 1.46e-24
Family Elongation factors 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|142339|estExt_Genewise1.C_100060
Sequence length 1028
Sequence
MAPKKKGNKKDQDDWEAELGETIAPADAAPAADDENGEDDEAGGGGLMAIMRKNKEKRKK
KGIVDEEPAPEPAKGKGGKGKPAPAAAKKDDADLEEPGRILTKAEKEKLKKEREKQRKKE
QAAAKKKPTTAKAPEPAKAAPTKDEAATEEAATPAPAETGGKKKKIPAHLAMIQKQQEEL
RRRQEEIARMDAEAKAKALEEEKLLAEEAKRKEEQKAIKKQREKERIEQLKKEGKFLTKA
QKEEKARNELKLQQMLAAGIKIGPQEEEGVPKKKAVYDSKKKRGKNDKKDEEAALAEAAE
RARLQAEKAAKEAEEKAAKEKAEAEAKAQAAKAAQESDIEDDWEAAANSGEEDDVKDSWD
ADSDEEAEKKSAAKKGEDEEGEEEDESDESDESESEDEAVSKAKQAEAQRKKEAAERREK
AHQAALAARSKDDLRSPICCILGHVDTGKTKLLDKIRQTNVQEGEAGGITQQIGATYFPV
EAIKAKTAVVNKNNEFEFKVPGLLVIDTPGHESFSNLRSRGSSLCNIAILVVDIMHGLEP
QTLESMRLLRDRKTPFIVALNKIDRLYGWKKVDNNGFQDSLALQSKAVQNEFKNRLEATK
LAFAEQGFNSELFYQNKSMAKFVSLVPTSAHTGEGIPDMLKLILQLTQERMVGSLMYLSE
VQATVLEVKAIEGFGMTIDVILSNGILREGDRIVLCGTEGAIVTNIRALLTPAPLRELRL
KSAYVHNKEVKAALGVKISAPGLEGAIAGSRLMVVGPDDDEEDICDEVESDLANLLSRVE
TSGRGVSVQASTLGSLEALLDFLKDCKIPVANVGIGPVYKRDVMQCGIMLEKAPDYAVML
CFDVKVDKEAMAYAEDQGIKIFQADIIYHLFDNFTKHMDEMLEKKKEESKMLAVFPCVLK
PVAIFNKTGPIVIGVDVTEGQLKINTPIAAVKTNSVTNAKEIIGLGRVTSIERDHKQIPV
CKKGQPSVAIKIEMGGHQPIYGRHLEEADLLYSQISRASIDTLKEFYRKDVTNEEWQLII
KLKPLFDI
Download sequence
Identical sequences jgi|Triat1|142339|estExt_Genewise1.C_100060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]