SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|146160|estExt_fgenesh1_kg.C_10103 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|146160|estExt_fgenesh1_kg.C_10103
Domain Number 1 Region: 9-103
Classification Level Classification E-value
Superfamily Translation proteins 1.17e-31
Family Ribosomal protein L35ae 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|146160|estExt_fgenesh1_kg.C_10103
Sequence length 109
Sequence
MPSESGHRLYVKGRHLSYQRSRNITHPGTSLIKIEGVDNTAAANFYAGKKIAYVYRGQKE
IRGTKIRVIWGKVTRPHGNSGVVRAKFAKPLPSKSFGASVRIMLYPSSI
Download sequence
Identical sequences G9P6K8
XP_013939113.1.20613 jgi|Triat1|146160|estExt_fgenesh1_kg.C_10103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]