SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|146236|estExt_fgenesh1_kg.C_20064 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|146236|estExt_fgenesh1_kg.C_20064
Domain Number 1 Region: 4-260
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.69e-81
Family G proteins 0.00000000568
Further Details:      
 
Domain Number 2 Region: 337-439
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.58e-42
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000324
Further Details:      
 
Domain Number 3 Region: 237-333
Classification Level Classification E-value
Superfamily Translation proteins 1.46e-29
Family Elongation factors 0.00000475
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|146236|estExt_fgenesh1_kg.C_20064
Sequence length 442
Sequence
MGKEEKTHINVVVIGHVDSGKSTTTGHLIYQCGGIDKRTIEKFEKEAAELGKGSFKYAWV
LDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADCAILIIAAG
TGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTANWAEARYLEIIKETSNFIKKV
GFNPKTVAFVPISGFNGDNMLAASTNCPWYKGWEKETKAGKSTGKTLLEAIDAIEPPKRP
TDKPLRLPLQDVYKIGGIGTVPVGRIETGILKPGMVVTFAPSNVTTEVKSVEMHHEQLVE
GVPGDNVGFNVKNVSVKDIRRGNVAGDSKNDPPMGAASFNAQVIVMNHPGQVGAGYAPVL
DCHTAHIACKFSELLEKIDRRTGKATEASPKFIKSGDSAIVKMVPSKPMCVEAFTDYPPL
GRFAVRDMRQTVAVGVIKAAKK
Download sequence
Identical sequences jgi|Triat1|146236|estExt_fgenesh1_kg.C_20064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]