SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|148319|estExt_Genewise1Plus.C_13485 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|148319|estExt_Genewise1Plus.C_13485
Domain Number 1 Region: 72-129,167-290
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-38
Family G proteins 0.00000382
Further Details:      
 
Domain Number 2 Region: 287-401
Classification Level Classification E-value
Superfamily Translation proteins 8.32e-36
Family Elongation factors 0.0000328
Further Details:      
 
Domain Number 3 Region: 402-497
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 4.8e-30
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|148319|estExt_Genewise1Plus.C_13485
Sequence length 508
Sequence
MSDDPKYDDIQSDSDSGESIDAQDNAVEEKALKPALKKSNPVIPDKTVAKPPLPPQTDPK
DLDVSILTPLTPEIIARQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELIRNITIKL
GYANAKIYQCDNAACPRPGCYRSYGSEKEVDPPCERDGCGGTYRLLRHVSFVDCPGHDIL
MSTMLSGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLENIIILQNKVDLMREEITQ
QHFDSILKFIRGTVAEKSPVIPISAQLKVNVDAVLDAIVNTIPVPVRDLSLSPHMIIIRS
FDVNKPGAEIDDLKGGVAGGSILHGVLKLGDEIEIRPGIVSRDNSGALKCTPLFSRVISL
NSEGNDLKYAVPGGLIGVGTQIDPTLCRADRLVGFVLGLKGKLPDIYSEIEINFYLLRRL
LGVKTADGKQAKVAKLAKNEVIMVNIGSTSTGAKVAAIKNDAAKLILTSPVCTDIGEKVA
LSRRIDKHWRLIGWATIAAGVTLEPSSA
Download sequence
Identical sequences A0A0W7VNY8 G9P7U5
XP_013939282.1.20613 XP_018661006.1.75393 jgi|Triat1|148319|estExt_Genewise1Plus.C_13485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]