SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|153342|estExt_Genewise1Plus.C_61174 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|153342|estExt_Genewise1Plus.C_61174
Domain Number 1 Region: 8-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.49e-97
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000358
Further Details:      
 
Domain Number 2 Region: 260-475
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.15e-56
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.000023
Further Details:      
 
Domain Number 3 Region: 590-754
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.84e-40
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.067
Further Details:      
 
Domain Number 4 Region: 516-584
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000335
Family AlaX-M N-terminal domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|153342|estExt_Genewise1Plus.C_61174
Sequence length 954
Sequence
MTGNWPEAQVRKTFFDFFEQRGHTLVPSGSVVPHNDPTLLFTNAGMNQFKPIFLGTVNKS
DPMSSLKRAVDTQKVIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKDAIEMAWE
LLTKVYGLDPSRLYVTYFEGNPALGLEPDLEAKELWQKTGVPEDHIIPGNMKDNFWEMGD
QGPCGPCSEVHYDKIGGRNAASLVNMDDPMVVEIWNLVFMQFDRQKDGSLKPLPAKHIDT
GMGFERLVSALQDTASNYATDVFTPLFKKIQEVTGARLYTDKYGAEDTDGIDTAYRVVAD
HIRTMSFAITDGAVPNNDGRGYVIRRILRRGVRYARKYLNAEIGSFFSKILPALVAQMGE
QFPDLAKKQLDIQEILDEEEEAFSRTLDRGEAQFERYAAKAAKDGVKKLDGDVVWRLYDT
FGFPVDLTKLMAEERGLDIDEAEVAVAREKAREASKAVKDSVQTFAKLDVHQIAELDTQL
KVPRTNDDAKYLKGDSKSKVQYIFDGKTFTKSTKDIPPNTAIGLLLDKTNFYAESGGQIA
DTGRIVIDDVVEFKVMDVQDFGGYVLHSGYIEYGELNSDDEVICEYDELRRSPIRNNHSG
THILNHSLREVLGEDVNQKGSLVDNDKLRFDFSHKTQVKLDELKKIEELSNKDIRANHKI
YAKDVELDLALKIEGLRAVFGETYPNPVRVVSIGMDVDTMLADPKKADWRQYSVELCGGT
HVEQTGLLKDLIIVEESGIAKGIRRIIAYTGEAAHKVQREAKLFEQKLVDLDNLPFGPEK
EAAVKTVSQDLSQLVISTLTKDEFNQRFQKIANAVVAEQKKKQKAESKTALDTVTKHFES
NKESQWFVGRLPISANAKAVGEVIKHYQSKYKEKSVYLFVGSQEEGAVAHGVYVGTHLAS
QGVTAEKWAASVSDVIGGRSGGKEPSRQGQGTQPEKIEDAVETARKWLDEKLKL
Download sequence
Identical sequences G9P9S0
XP_013938550.1.20613 jgi|Triat1|153342|estExt_Genewise1Plus.C_61174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]