SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|156281|estExt_Genewise1Plus.C_120388 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|156281|estExt_Genewise1Plus.C_120388
Domain Number 1 Region: 4-367
Classification Level Classification E-value
Superfamily Translation proteins 3e-109
Family Ribosomal protein L3 0.00000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|156281|estExt_Genewise1Plus.C_120388
Sequence length 391
Sequence
MSHRKYEAPRHGSLAYLPRKRAARHRGKVKSFPKDDAKKPVHLTATMGYKAGMTTIVRDL
DRPGAKANKKEVVEAVSIIDTPPMIVVGLVGYIETPRGLRSLTTVWAEHLSDEVKRRFYK
NWYKSKKKAFTKYAKKHSDNSGSTITRELERIKKYCTVVRVLAHTQIRKTPLKQKKAHLM
EIQINGGSVAEKVDFGKDLFEKPVSIDSIFEQDEVIDVIAVTKGHGFSGVTSRWGTKKLP
RKTHKGLRKVACIGAWHPSHVQWTVARAGQEGYHHRTSVNHKVYRIGKGDAEDSASTETD
VTKKKITPLGGFVRYGEVNNDFVMVKGSIPGTKKRVVTLRKSMWTHTSRKALEKISLKWI
DTSSEFGHGAFQTPAEKKQFQGTLKKDLASA
Download sequence
Identical sequences G9NJH8
jgi|Triat1|156281|estExt_Genewise1Plus.C_120388 XP_013947211.1.20613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]