SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|36917|e_gw1.3.781.1 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|36917|e_gw1.3.781.1
Domain Number 1 Region: 83-262
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.27e-48
Family G proteins 0.00014
Further Details:      
 
Domain Number 2 Region: 412-517
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 1.7e-26
Family Initiation factor IF2/eIF5b, domain 3 0.0024
Further Details:      
 
Domain Number 3 Region: 518-615
Classification Level Classification E-value
Superfamily Translation proteins 4.01e-25
Family Elongation factors 0.00018
Further Details:      
 
Domain Number 4 Region: 266-344
Classification Level Classification E-value
Superfamily Translation proteins 9.72e-16
Family Elongation factors 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|36917|e_gw1.3.781.1
Sequence length 618
Sequence
QAKQTEPQTVPIFLPEYISASNLSKALKQNVTPFLQDMEEMGFENITSDTIFTGETAALI
AMEYGFEPTVDTGSLRDLRPRPLLEDVSTLPSRPPVVTIMGHVDHGKTTLLDWLRKSSVA
AQEHGGITQHIGAFIVKMSSGKSITFLDTPGHAAFLSMRQRGANVTDIVVLVVAADDSVM
PQTLEALKHATSAKVPIIVAITKVDKEDARIEQVKADLSRHGVEIEDYGGDVQVVCVSGK
TGQGMEDLEENIVTLSEILDVRAEDDGMAEGWVLESSIKPQGKAATILVKRGTLRPGDLI
VAGKTWARIRVLRNEAGLEVDSAPPGTPVEILGWRELPSAGEQVLQSPDEAKAKTAVEYR
QEMAGREQSSIQLAEQEQRQREKAAADAAAAATETEGAPKATAGEPTATGIFTQNFTVKA
DVVGSVEAVCGTVLELGSHEVHPKILRSSAGQITEYDIDHAATSNSIIINFNCTIPPHIK
QRAEEAKVKILDHKVIYHVIDDVKAALSDLLPMNVTFRVNGEADVLQVFPINLKKRVFRN
IAGCRVRNGSIKRSSRVKVIRKGEVIYDGKLDTLKHVKKDVQEMGKGTECGIGLEDFDDF
QADDQIQTYEEIKERRSL
Download sequence
Identical sequences jgi|Triat1|36917|e_gw1.3.781.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]