SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|43212|e_gw1.7.216.1 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|43212|e_gw1.7.216.1
Domain Number 1 Region: 187-434
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.94e-30
Family G proteins 0.0025
Further Details:      
 
Domain Number 2 Region: 416-544
Classification Level Classification E-value
Superfamily Translation proteins 8.84e-19
Family Elongation factors 0.001
Further Details:      
 
Domain Number 3 Region: 514-600
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 8.63e-17
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|43212|e_gw1.7.216.1
Sequence length 638
Sequence
MATKTKTAKGLEHEKRKGESALSDFAEYVEQQQNLRYPASAKKPADSVEHDVELDELLDS
LNLVDSAPRVKLKDLVLRSDDDTLKKLGDVIVERIEEGAGETVFDLGFENSGESMQLTPQ
EWHQAYTRLVEAAKRVGADCQLLLTTNVGGKEEAESTATSPTKDKSCSGKILIRRIPGKI
EDVIETRIAVVGNVDAGKSSLLGVLVKNDLDDGRGRARVNLFRHKHEMETGRTSSVGMEI
MGFDSLGQVVTSDTPGRKLSWEDIGKRSAKVITFSDLAGHEKYLRTTVFGLLSSSPDFCL
LMVAANNGLVGMSKEHLGIALALNVPVMVIITKIDICPPNILKETISQVNKIMKSPGARK
MPTFITNREECINTATQFVSKRICPVFQVSNVTGENLDLVRLFLNMLPHHGHYHSDAPFE
FQVNDTFSVPFTGTVVSGIVKSGMVHEGDNVLIGPDSLGHFTPTAVRSIERKRIRVHVAE
AGQSASFALKKMKRRDVRKGMVMLHKEEGQTGPRVFQEFVAEVLILSHATTIKKRYQAML
HVGAVSQTCAIIDIDRELIRTGDRANVAFRFVQRPEYIAPGDRLLFREGRTRGLGIVKSV
GYDPKQPLMSAPEDVIGQAEDVEQQSVVGEANDVASGT
Download sequence
Identical sequences G9NRT4
jgi|Triat1|43212|e_gw1.7.216.1 XP_013944416.1.20613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]