SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|51248|e_gw1.14.64.1 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|51248|e_gw1.14.64.1
Domain Number 1 Region: 296-487,530-557
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000113
Family G proteins 0.027
Further Details:      
 
Weak hits

Sequence:  jgi|Triat1|51248|e_gw1.14.64.1
Domain Number - Region: 577-622
Classification Level Classification E-value
Superfamily Translation proteins 0.0642
Family Elongation factors 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|51248|e_gw1.14.64.1
Sequence length 857
Sequence
MASVFTYDPDPPRVSSPWILADDADTSPASGAAVTQTGLLSEYGVTRLDAEPQTGPIEYK
LHLLLRSRRGYVYMSTADQKRDRFHAQPGDGSALYSASPASYSASPTPASSSQPRQERLQ
RLTTQLLWRLQQSSPYHASSSREVKIPKLPDGSTDADSPDLYGTQIPGLEESQGALYEIG
VSDDGHLVGLAKDELDESIATLRIMAASLGCGVTVLRMVIVGDCEWIEIADLNGNASQGP
TQVAKRDRLWVAEALITPSTELLHSKDTKRYTESAEGTPVDSAASTTVPGHGKSTTPQLR
VTLTGPIASGKSSLLGTLSTGTLDNGRGKSRLSLLKHRHEMASGMTSSIAQELIGYKERL
IFSFSHRNIESWLDIHDYANDGRLVFMSDSGGHPRYRHTVFRGLMNWAPHWMVLCIAADD
AEMTSRAHDVTAPAPDSGETDLVKAHLDLSLKLDVPLAIVITKLDLASKVALQKTMTKIL
GAIRDADRVPKLLQPDQQPRDQLSEIPQTDWDKVQSFVGNISEQDLLKRVPIVFTSVLKG
VGIGLVHALLASLPLPPAPTSHSSRDASPQSEQPRNIFHIDDTFSLPRSFDDSLANLDGV
IVSGHVRLGSFSIGQTIVVGPFSSSHALDRGSGTEYQSSPEGRGSPALRAISATHSNGNK
SGGSVSPSTDSDEWQKARIVSIRNLRLPVGTLEAGQVGSIGLVFETNHSDLTVLPDPPQI
RRGMVISTPTMDMPDSEMPLHASRGFTAVFEEDGAQFPPSGTLVNVLFACVRTAARILDV
SVQHRGETGETIGPLDADQKAETTKDSSRDTVTKVTIELVHSRKWAELGSSVIIMGNGSH
DGSGLQGFVGKITDVVC
Download sequence
Identical sequences G9NHL0
jgi|Triat1|51248|e_gw1.14.64.1 XP_013948259.1.20613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]