SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|83566|fgenesh1_pm.C_scaffold_17000041 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|83566|fgenesh1_pm.C_scaffold_17000041
Domain Number 1 Region: 6-360
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.81e-86
Family G proteins 0.000000597
Further Details:      
 
Domain Number 2 Region: 836-948
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.77e-26
Family EF-G/eEF-2 domains III and V 0.00051
Further Details:      
 
Domain Number 3 Region: 367-416,483-567
Classification Level Classification E-value
Superfamily Translation proteins 4.01e-22
Family Elongation factors 0.003
Further Details:      
 
Domain Number 4 Region: 583-656
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.73e-17
Family EF-G/eEF-2 domains III and V 0.00053
Further Details:      
 
Domain Number 5 Region: 658-709,750-801
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000258
Family Translational machinery components 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|83566|fgenesh1_pm.C_scaffold_17000041
Sequence length 972
Sequence
MPVVTPEKLASLQKQSQDVRNICILAHVDHGKTSLTDALLATNGIISPKLAGKIRYLDSR
PDEQTRGITMESSAISLYFSMLRRSAPDATPEAKEYLINLIDSPGHIDFSSEVSTASRLC
DGAVVLVDAVEGVCSQTVTVLRQSWIEKLKPLLVINKIDRLVTELKMTPQEAYVHLSKLL
EQVNAVLGSFFQGERMEEDLNWRERMEEQLDDEDLYFAPEKNNVIFSSAIDGWAFTCRQF
ASLYEKKLGIKRGIMERCLWGNFYLDPKTKKVLGQKHLKGRNLKPMFVQLVLEPVWTVYQ
ATIGADGGRGDPALLEKVTKSLNITIAPHILRARDPRLLLTTVFASWLPLSTALLVSVIE
SLPSPPTAQAERLPSVIDESPDAQCIDKSVRDAMVSFKTEKSDPVVAYVSKMVSIPESEL
PENKRRTGQMTGEEARELARQKRAAAAALAAANNPSEEDMMTQALETVNLDDITPAAEEE
KIDPEHLIGFARIFSGTLSVGDTLYVIPPKWSPANPHADPEPQQITVKSLYMFMGRSLEA
LNSVPAGVVFGIGGLEGKILKSGTLCSTLEGAVNLAGISLAGKPIVRVALEPVNPADLDK
MIQGLHLLVQSDPCAEYEQFASGEHVLLTAGELHLERCLLDLKERFARCDIQAGAPIVPY
RETIVKAEEMRPPANKELGRGTIVSSTSSKQVNLTLRVQPLPTNVTDFLVKNGDAIKRLY
NVRKLVEEGGEESNEEAIEADTELTAGAAISVEELKTQLQKELETGKGREGWKGLVDRIA
GFGPRRTGPNLLIDATKDGILPKIFAAAKAPDATPGRSNRHYAQPSWTGLRDSCSPCTXV
EIQTSTEVLGRVYDVLTRRRGRVVSEAMKEGTPFFTIQAMLPVAESFGFADEMRKRTSGA
AQPQLIFAGFEILDEDPFWVPFTEDDLEDLGELADKENVAKRYMDGVRKKKGLLVEGRTV
ARDAEKQKTLKR
Download sequence
Identical sequences jgi|Triat1|83566|fgenesh1_pm.C_scaffold_17000041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]