SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|91666|fgenesh1_pg.C_scaffold_11000119 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|91666|fgenesh1_pg.C_scaffold_11000119
Domain Number 1 Region: 7-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.84e-49
Family G proteins 0.00000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|91666|fgenesh1_pg.C_scaffold_11000119
Sequence length 235
Sequence
MAGRMVLYKLVVLGDGGVGKTALTIQLCLQHFVETYDPTIEDSYRKQVVIDGQPCMLEVL
DTAGQEEYTALRDQWIRDGEGFVLVYSIASRSSFTRIKRFHHQIQRVKESVASSPSYPGS
PLSATNSQLPVPIMLVGNKSDRVTEREVSTQEGHALARELGCEFVEASAKNCINVEKAFY
DVVRILRRQRQQASRPAAGSSGRTRTSNGEVGGGGRDSHKYGRGGGKGKSKCIVL
Download sequence
Identical sequences A0A0W7VYY7 G9PBH3
XP_013937876.1.20613 XP_018664640.1.75393 jgi|Triat1|91666|fgenesh1_pg.C_scaffold_11000119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]