SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|127425|estExt_fgenesh1_pm.C_20004 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|127425|estExt_fgenesh1_pm.C_20004
Domain Number 1 Region: 44-518
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.35e-165
Family GABA-aminotransferase-like 0.000000000379
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|127425|estExt_fgenesh1_pm.C_20004
Sequence length 523
Sequence
MAAYLRSRAMPLGSLKRLATRPPSVNAASLIARRAKASLAQDGQQQLLSAHLEKADPAVF
DIIEREKNRQKHFINLIPSENFTSQAVLDALGSVMQNKYSEGYPGARYYGGNEVIDQSER
LCQQRALEAFGLDSKNWGVNVQGKSSIVRRLYLATLMDTHDRLMGLDLPHGGHLSHGYQT
PTKKISAVSKYFETLPYQLDERTGYIDYDNLEKLATIYRPKIIIAGTSAYSRLIDYQRIR
EICDKVNAYMVADMAHISGLVAAKVLPGPFPFADIVTTTSHKSLRGPRGALIFFRKGVRR
QNPKTKEDEMYDLEGPINNSVFPGHQGGPHNHTITALAVALKQTQTPEFQAYQSQVLANA
KAFAKRLGEDKGKGGLGYNLVSGGTDNHLVLVDLKPHGIDGSRVERVLELVGVAANKNTV
PGDRSALVPGGLRMGTPAMTTRGFREDDFVRVADVVDRAVTIATRINKTVRAAAQERGEK
SPGKLKLFVEHLGNGDRDPEIVQLKSEVADWVGTYPLPWDAAQ
Download sequence
Identical sequences jgi|Triat1|127425|estExt_fgenesh1_pm.C_20004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]