SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|128844|estExt_fgenesh1_pm.C_90141 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|128844|estExt_fgenesh1_pm.C_90141
Domain Number 1 Region: 102-515
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.46e-107
Family Pyridoxal-dependent decarboxylase 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|128844|estExt_fgenesh1_pm.C_90141
Sequence length 566
Sequence
MPGSSRIPQSLRGSLESVKRRRQALSLSVINLDLLKNILFFFFVLRYTRRLWWKLKGRGI
IGAILELYRDIERTLYGYFLRAPGVRGQVQKKVKESLEKMSNKLVPPGQTKYLTLPKEGM
TDEAVRAELDALANMDHTRWEDGFVSGAVYHGEDELLKLQAEAFGKFTVANPIHPDVFPG
VRKMEAEIVSMVLNMFQAPPGAAGVTTSGGTESILMAVLSARQKAYNERGVTEPEMILPA
TAHTAFRKAGEYFKIKIHYVDCPAPSYQVDVRRVSRLINRNTILLVGSAPNFPHGIIDDI
AALSKLAQRKKLCLHVDCCLGSFVIANLEKAGFESTLFDFRLKGVTSISCDTHKYGFAPK
GSSTVLYRNAELRSYQYFVSPDWAGGVYASPGMAGSRPGALIAGCWASMMRLGEAGYVDA
CVKIVGTTKKIAEAIQNGPVLGGELDLIGKPLVSVVAFNAKTLNVYDIADGMSSKGWHLN
ALQSPPAIHVAVTMPIVKVWERLVGDLETVVEEEREKERVRLVEGKGAKGKAMGDSAALY
GVAGSLPNKGVVVDLATGFLDLLYKV
Download sequence
Identical sequences G9NPS8
XP_013945297.1.20613 jgi|Triat1|128844|estExt_fgenesh1_pm.C_90141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]