SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|130416|estExt_fgenesh1_pg.C_11009 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|130416|estExt_fgenesh1_pg.C_11009
Domain Number 1 Region: 139-544
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.04e-101
Family GABA-aminotransferase-like 0.0000000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|130416|estExt_fgenesh1_pg.C_11009
Sequence length 615
Sequence
MDSVLRQSKAMCPFLKSASPATLRAMSTATRPSARASPCGGTMSKLQLYAHRCPVMGKAM
AVQSSKYGAAAGIRAFSAQSRSDKARIHTSRNQEARAVESPILDGRKNAPPPPPTATAPR
KDVPPVVASAFTSAGKFAYEDFYQAELDKKRKDKSYRYFNNINRLAKEFPVAHMADKKDK
VTVWCANDYLGMGGNQHVLDTMHKALEEYGAGAGGTRNISGHNKHAVELEATLAKLHATE
SALMFSSCYVANDATLATLGSKLPECVILSDSLNHASMIQGIRHSGTKKIVFKHNDVADL
EAKLASLPLHVPKIIAFESVYSMCGSIGPIEEICDLADKYGAITFLDEVHAVGMYGPSGA
GVAEHLDWEAHAAGRPRGTIMDRIDIFTGTLAKAYGTVGGYIAGSAKFVDMIRSLAPGFI
FTSTLPPATMAGANASIKYQMAYDGDRRLQQLHTRAVKEELNARDIPVIPNPSHIVPILV
GNAALAKEASDLLLKDYKIYVQAINYPTVPVGQERLRVTPTPGHTKELREELVSALDEIW
TRLDIKRTSQWAAEGGFIGVGVEGNEPEPLWTDKLLNIEQATQEAKAAGVAANGITEALL
AREASNAGRAMDVSA
Download sequence
Identical sequences G9P4P5
XP_013939565.1.20613 jgi|Triat1|130416|estExt_fgenesh1_pg.C_11009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]