SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|143020|estExt_Genewise1.C_110139 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|143020|estExt_Genewise1.C_110139
Domain Number 1 Region: 116-450
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.8e-85
Family G proteins 0.00000204
Further Details:      
 
Domain Number 2 Region: 675-841
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.57e-54
Family Translational machinery components 0.0000282
Further Details:      
 
Domain Number 3 Region: 451-579
Classification Level Classification E-value
Superfamily Translation proteins 3.03e-32
Family Elongation factors 0.0003
Further Details:      
 
Domain Number 4 Region: 842-927
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 9.59e-22
Family EF-G/eEF-2 domains III and V 0.00053
Further Details:      
 
Domain Number 5 Region: 595-671
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.19e-17
Family EF-G/eEF-2 domains III and V 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|143020|estExt_Genewise1.C_110139
Sequence length 983
Sequence
MDDLYDEFGNFVGEEVESEEASEAGDEAADYAYDDEQEEAPSVTGQELMELDDGPSNAVI
LHEDKQYYPTAEQVYGAEVETRVEEVDAQPLTQPIIAPIEQKKFNIEEVDLPPVFFDREF
MADLMNFPEQTRNIALAGHLHHGKTAFMDMLVLETHDITDRLDRRVGKKRDEALRYTDVH
VLERERGISIKAAPMSLVLQSTKGKSHLLHIVDTPGHVNFVDEVAAAFRLVDGVCLVVDV
VEGVQINTEQIIKHAVLEDIPLTLIINKMDRLILELKLPPKDAYFKLKHVVEEVNTVIAN
TVPTKAASKRLSPEKGNVLFACTDMGWCFTLPSFAKMYTDTFGDINAEEFARRLWGDVYY
NPKKRNFTRKPAEDRSARSFVHFVLEPIYKIFTHAISDSPEQLRLVLSSLGIELKPSQYK
ADANVILKLVCEQFFGPSTGFVDMVVKHIPSPADGAQRLLERYYTGPLDTKVATSMQTCN
QDGPLVVHVSKLFNTSDAKSFYSFGRVLSGTARPGATVRVLGEGYSLDDEEDMTTASIGE
VFIAETRYNIPTDGVPAGNLVLLGGIDNSIVKTATVVPSKLEDDEDAFIFRPITHFTESV
LKVAVEPINPSELPKMLDGLRKIQKSYPLINTKVEESGEHVVLGTGELYMDCVLHDLRKL
YADMDIKISDPVTRFCETVVETSATKCYAITPNKKNKITMVAEQLEKGISNDIETGAVRI
RDPIRKTAKFFEDNHGWDKLAARSIWAFGPDEMGPNILQDDTLPTEVDKKLLTTVKESIR
QGFSWATREGPLCEEPIRNTKFKVTDVVLANEAIFRGGGQIIPTSRRACYSSFLMASPRL
MEPVYSVSVTGPEDSYMEVYNVLARRRGHVLSDGPVAGTPLYRVNGLIPVIDSFGFETDL
RIKTQGGSMVSLVFDSWSIIPGDPLDRDQVTRPLQPAAAQATARDFVLKTRRRKGLSEDV
SVKTFLEPEFYQSLMESGMLGDI
Download sequence
Identical sequences G9PBP8
XP_013937950.1.20613 jgi|Triat1|143020|estExt_Genewise1.C_110139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]