SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|149780|estExt_Genewise1Plus.C_21905 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|149780|estExt_Genewise1Plus.C_21905
Domain Number 1 Region: 53-100,128-523
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.73e-70
Family AAT-like 0.0000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|149780|estExt_Genewise1Plus.C_21905
Sequence length 534
Sequence
MGSLPVELDQCTAAPSLYPNRKPVPPAQRGIAAPCSTEQFKTKSYKHKPLAKRWHPYMST
ESANRTGSSLKASMKHLANPNVISLGGGTPLSDFIPFDEVVIRPPSLENLKTDKKRNSTS
VTTLHATKHDIADGTSIYDLSVALNYGQGYGSAQFMRWITEHTEIFHDPPYSDWQCSLTI
GNTSAFDMCLRMLTEPGDCVLADKYTFSTAIETAQPLGISFVGIDMDREGMLPDSLGEVL
ENWDPAAHKNARKPSVLYAIPTGQNPTGTTQSLERRKEIYKVAQQHDLIILEDDPYYFLQ
MDPYTSSSADKSSDAEIRSSADFLKKLIPSYLSLDVDGRVIRMDSFSKVISPGARLGWVT
APAQLIERYKHHTDVSTQSPAGLSQLAVFKLVDEHWGHAGYAEWLMHLRSEYTKRRDVII
SACERYLPRKIVSWEPTEAGMFQWLKVDWKQHPDAKTKSADVLEEEIWLESISTGALVGR
GSWFRASVDVAHDEVFYRTTFAAAPLPKIEEAVKRFGETIEKVFEIGLVKIEES
Download sequence
Identical sequences G9P2R8
jgi|Triat1|149780|estExt_Genewise1Plus.C_21905 XP_013941032.1.20613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]