SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|153885|estExt_Genewise1Plus.C_70802 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|153885|estExt_Genewise1Plus.C_70802
Domain Number 1 Region: 207-586
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.31e-96
Family GABA-aminotransferase-like 0.00000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|153885|estExt_Genewise1Plus.C_70802
Sequence length 646
Sequence
MSASEKTGERRLSSSKTNRLSQLFSSSPKSKDQSPLAAMPQSQMNTISPSTVSLPTISLS
TATGEPNSIEPTKMLFKPQSAEEQEQRRLAESQFGPLLDPSHRYVSQSNGETFKEPIEDM
PPYFYLLTTYLSYLFLIIIGHCRDYFGKRFGDKKRYNALKVQNGLAPLTDDFDSFYSRRL
KGRLDDCFARPTYGVPGRFITLKERTADRLNRNYHYTGNHVETLNVSSYNYLGFAQSQGP
CADAVDECVKKYGVTAASPRGDSGTSDLALEVEREVASFVGKPEAMVFSMGYVTNSSTFP
ALVSKGCLIVSDELNHASIRVGARLSGAVIQSFKHNDVVALERVLREAISQGQPRTHRPW
KKILVVVEGLYSMEGTMVNLPAIVALKRKYKFYLYVDEAHSIGALGPRGRGVCDYFGVDP
SEVDILMGTLTKSFGANGGYIAAEKHIIDKLRSTNVCSIYGEAPSPFVLMQILTSIKLIN
GEICPGQGEERLQRIAFNSRYLRLGLKRLGLIVAGSDDSPIIPVLLYNPGKMPAFSREML
KRNISVVIVGYPATPLISSRARFCISAAHNKDDLDRMIRACDEVGDMLQIKFSSGIAGGL
EPLPAGVAPENEAEWRRANNVAIRPPRWDVEEVIRRGAVDCKLPLR
Download sequence
Identical sequences jgi|Triat1|153885|estExt_Genewise1Plus.C_70802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]