SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|80754|fgenesh1_pm.C_scaffold_7000126 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|80754|fgenesh1_pm.C_scaffold_7000126
Domain Number 1 Region: 186-346
Classification Level Classification E-value
Superfamily E set domains 0.0000063
Family Arrestin/Vps26-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|80754|fgenesh1_pm.C_scaffold_7000126
Sequence length 404
Sequence
MASAPASVRVSGPPNRSFLVGYPGISATLPRIEGKVEIRPGQGYSMPVPVSLVRISLQKR
ETIHPDADSLTKRHLGAPRKETTDLVGKEVLLFRCSSGKGAEDVYSMDLPFIIFIPFGRG
GEETNRRIPPASLQLPSRIAETYYELVVTVQQGHKDQYRYSFPLPILRYDTLSTFGMYNK
PETKQITSDNLVHLAINLPRWSYGPNDPITVYIKIAPNSDWWNKAKKVTIDKITLGIEEE
ITFNPEGDEPSKKVNKLAKQVQVVKTKLPEAGYATNIGLVFPAKDLRDSEGIIKRGRPAF
PQYEVASFTTSSTLYKIEFYLSIKVQVSGARDLHLRQPIVICPLDQQGCKEEMDAIEIAA
REASHVDPNNPMVPARTIVLANDRDALRALGLCMVGKVKKPFIE
Download sequence
Identical sequences G9NSI0
XP_013944608.1.20613 jgi|Triat1|80754|fgenesh1_pm.C_scaffold_7000126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]