SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triat1|92969|fgenesh1_pg.C_scaffold_14000195 from Trichoderma atroviride

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triat1|92969|fgenesh1_pg.C_scaffold_14000195
Domain Number 1 Region: 6-123
Classification Level Classification E-value
Superfamily YjgF-like 1.51e-39
Family YjgF/L-PSP 0.0000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triat1|92969|fgenesh1_pg.C_scaffold_14000195
Sequence length 125
Sequence
MADQTIVYTKEAPFPLGPYSQAIKTPTAIYCSGQIPLTADGTLIEGTIAEKTRKCCENLD
VVLKQAGSSLPRVVKTTIFISDMAHFAEMNGEYEKFFSHKPARSCVAVKTLPKGVDVEIE
AIALP
Download sequence
Identical sequences jgi|Triat1|92969|fgenesh1_pg.C_scaffold_14000195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]