SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410419568|ref|YP_006900017.1| from Bordetella bronchiseptica MO149

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410419568|ref|YP_006900017.1|
Domain Number 1 Region: 485-597
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000116
Family Anti-sigma factor antagonist SpoIIaa 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410419568|ref|YP_006900017.1|
Sequence length 631
Comment sulfate transporter [Bordetella bronchiseptica MO149]
Sequence
MRVRGHGFTLAPFDATAGASGRGAGYKVNKMGKTVRGGAAAILGGWVNDITPGTLRADAQ
AGLLGALLVLPQGVAFAMLAGLPPEYGLYSAIVPCIVAALFGSSRHVLSGPTNANSLALF
AVLAPLALPGSPGYIQMALAVTILVGVMQLAVGLLRLGSLANFISPSALFGFTSGAALLI
AVHALKDALGLEGVQAHSAGAVLAAVGSRLGEAHWGASVVALTTIIVTLLVRHWDRRKPH
MLAGLAAGTLLAAALNAGVFTAAGQPISVLGALAQPWPPFHVPAVQWSVLPDLVGVAVPL
TIVALAQSISIAKAVAMRSGQLIDANREFIGQGLSNVVGGLFSSYLSCGSLNRSVPNYEA
GARTPMAAVFAALLLVLLVLVSSPVLALIPHAAIAGLLIVVAWSLLDLPRWRVLVRIAPR
EALIAAATLAATVTIRMEIAILLGTLLSLTAYLYRTARPAMRPMGFDAADPQRHFAVLEG
QPGELPECPQLKLLRMEGSVYFGAATHVTDRLQALRAGASAGQRHLLVMSKSMNFIDHAG
AQVWEEELRRRRAGGGDLYFHRPRPEVLRDWRRSGFIDRLGADHIFPDKATAIHTIYERL
DPEICRGCTARIFTECGPPGTAHQPGAERAE
Download sequence
Identical sequences A0A063USG6
gi|410419568|ref|YP_006900017.1| WP_004568615.1.101424 WP_004568615.1.22732 WP_004568615.1.23701 WP_004568615.1.31246 WP_004568615.1.31572 WP_004568615.1.31632 WP_004568615.1.33898 WP_004568615.1.42576 WP_004568615.1.43447 WP_004568615.1.47170 WP_004568615.1.56758 WP_004568615.1.56782 WP_004568615.1.5701 WP_004568615.1.63791 WP_004568615.1.65401 WP_004568615.1.67928 WP_004568615.1.69835 WP_004568615.1.77807 WP_004568615.1.86646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]