SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CAOG_03448T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_03448T0
Domain Number 1 Region: 51-175
Classification Level Classification E-value
Superfamily DOPA-like 1.03e-23
Family DOPA dioxygenase-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CAOG_03448T0
Sequence length 182
Comment | CAOG_03448 | Capsaspora owczarzaki ATCC 30864 hypothetical protein (183 aa)
Sequence
MMNKAVPTLAVLVALAMAIGSVGVADAHSTHYPHLKYLVGNASACQDVDQVPILSYHVHI
LFWQNNEKSTADALALRQVAMDHFNLTNAPLCTGLFDQGRLCAFEPDMVPAGPFVVAQWS
FYFTTEQTGLIIPWFLQHHEPFTVLFHPNTGCEIEDHTTWAVWGGRPGEIDTSFLTHEEP
GN
Download sequence
Identical sequences CAOG_03448T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]