SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CAOG_05814T0 from Capsaspora owczarzaki ATCC 30864

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CAOG_05814T0
Domain Number 1 Region: 212-258,303-439
Classification Level Classification E-value
Superfamily Fibronectin type III 7.54e-33
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 2 Region: 446-642
Classification Level Classification E-value
Superfamily Fibronectin type III 9.85e-24
Family Fibronectin type III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CAOG_05814T0
Sequence length 709
Comment | CAOG_05814 | Capsaspora owczarzaki ATCC 30864 hypothetical protein (710 aa)
Sequence
MSSPPYARSPGNGGAPAAAASSSASDMMPAFMTGGRKKSSTPSAARFATTRELSFTDEES
SLLQSDAFNRPAPQRPSSFGSLSASSSASLYGSSPSVAGHTGGGYGASSGGSHSSNGRFK
RGSGTSSSNGFGSAPSSTGFQPVRYTNINGELRKLPPEPVCELCCRCCTPRVCLISIILM
LLLGAGVGALVYWVILPAVDANNGTPTVVVGPGIPDPPAATAINSTHIQLVWEPPNSSGT
DPISYYELLRCNGGNGTLPDTDTDTTARKQDDATADADSDSGAALSIDAADPAPCTFLRA
YRGPLLTFYDINLNASTTYCYAVRAASVAGIGNFSAVSCVTTLPPDPPLPPTSIVPTGSS
TETISIEWNNANGQGAPILAYFLQYKPSSSNQWIPLYPVLVQQWSIIDLSEGTSYDIQAA
ASNIVGMSNWSSTFTFHTDTNKATVSSAPGHPASVLVDVTYATIAWTAPASDGGAIVTLY
DMNANITSLNGSHAELTNLCDTPTLACTLGMFSAGDRVCVAVRAKNSQGWSEFSAAECFQ
TLSAGVPATMPPPVELAITGNSISLGWTPPDDKGSPIQRYTLQRDDWWNDSPIATIHSDL
SLNFTDDYNGQGLLPATVYNYRIRAENLIGPGNFSLEVGIVTEVNGTCGNPADVALFKSE
SSTLRSALNSCFVKCLTRAKCTTTYWLVSAMFLVLGSGDYMCCSEMRCL
Download sequence
Identical sequences CAOG_05814T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]