SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56415158|ref|YP_152233.1| from Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56415158|ref|YP_152233.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.79e-111
Family FMN-linked oxidoreductases 0.0000000000458
Further Details:      
 
Domain Number 2 Region: 333-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 3.53e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000000941
Further Details:      
 
Domain Number 3 Region: 461-518,556-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.74e-27
Family C-terminal domain of adrenodoxin reductase-like 0.00000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56415158|ref|YP_152233.1|
Sequence length 672
Comment 2,4-dieonyl-coa reductase [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150]
Sequence
MSYPSLFAPLDLGFTTLRNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGVALIVTGGI
APVPSGVVMTGGAMLNDASQLKPHRVVTDAVHAQGGKIALQILHTGRYSYQPHLVAPSAI
QAPINRFMPHELTHDEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTRRTNHR
DDEWGGDYTSRMRFAVEVVRAVRQRVGNDFIIIYRLSMLDLVENGGTFDETVQLAQAIEA
AGASLINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSVPLIATNRINDPQVAETIL
TRGDADMVSMARPFLADAEFLTKAQSGRADEINTCIGCNQACLDRIFIGKVTSCLVNPRA
CHETHMPITPAIRKKNLAVVGAGPAGLAFAINAASRGHHVTLFDAQSEIGGQFTIARQIP
GKEEFYETLRYYRRMIDITGVTLKLNQRVNAEDLQPFDEAILACGIVPRRPPIDGIDHPK
TLTYLEVLRDKAPVGKRVAIIGCGGIGFDTAMYLSQHGESTSQNIAEFCTEWGIDTSLQQ
AGGLRPEGPRLARSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYQKI
DDDGLHLLIGGEPQLLEVDHVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAMELDARQ
AIAQGTRLALEI
Download sequence
Identical sequences A0A0H2WSV1 A0A2J1A4J9
gi|197364088|ref|YP_002143725.1| 295319.SPA3087 554290.SSPA2883 WP_000121509.1.101111 WP_000121509.1.101239 WP_000121509.1.101904 WP_000121509.1.11810 WP_000121509.1.12210 WP_000121509.1.12308 WP_000121509.1.12865 WP_000121509.1.13262 WP_000121509.1.13602 WP_000121509.1.13967 WP_000121509.1.15011 WP_000121509.1.15938 WP_000121509.1.16710 WP_000121509.1.18355 WP_000121509.1.19882 WP_000121509.1.20564 WP_000121509.1.2139 WP_000121509.1.21534 WP_000121509.1.22451 WP_000121509.1.22566 WP_000121509.1.24394 WP_000121509.1.25846 WP_000121509.1.26122 WP_000121509.1.26750 WP_000121509.1.30555 WP_000121509.1.31069 WP_000121509.1.31546 WP_000121509.1.329 WP_000121509.1.33420 WP_000121509.1.33504 WP_000121509.1.34424 WP_000121509.1.35331 WP_000121509.1.35507 WP_000121509.1.36057 WP_000121509.1.36586 WP_000121509.1.36875 WP_000121509.1.38452 WP_000121509.1.38620 WP_000121509.1.39112 WP_000121509.1.39953 WP_000121509.1.40031 WP_000121509.1.40688 WP_000121509.1.42098 WP_000121509.1.4229 WP_000121509.1.42372 WP_000121509.1.44144 WP_000121509.1.44606 WP_000121509.1.44687 WP_000121509.1.4505 WP_000121509.1.47023 WP_000121509.1.47243 WP_000121509.1.47660 WP_000121509.1.48134 WP_000121509.1.48510 WP_000121509.1.48768 WP_000121509.1.49430 WP_000121509.1.49494 WP_000121509.1.49790 WP_000121509.1.50153 WP_000121509.1.50529 WP_000121509.1.5185 WP_000121509.1.52101 WP_000121509.1.54340 WP_000121509.1.5462 WP_000121509.1.55200 WP_000121509.1.56374 WP_000121509.1.56791 WP_000121509.1.56942 WP_000121509.1.57244 WP_000121509.1.5761 WP_000121509.1.58467 WP_000121509.1.59068 WP_000121509.1.59276 WP_000121509.1.60809 WP_000121509.1.61309 WP_000121509.1.6143 WP_000121509.1.61694 WP_000121509.1.62063 WP_000121509.1.62195 WP_000121509.1.64758 WP_000121509.1.65475 WP_000121509.1.65818 WP_000121509.1.65945 WP_000121509.1.67228 WP_000121509.1.67825 WP_000121509.1.69433 WP_000121509.1.69839 WP_000121509.1.7060 WP_000121509.1.70662 WP_000121509.1.71656 WP_000121509.1.71848 WP_000121509.1.72121 WP_000121509.1.72254 WP_000121509.1.72797 WP_000121509.1.72946 WP_000121509.1.73102 WP_000121509.1.73958 WP_000121509.1.74741 WP_000121509.1.75371 WP_000121509.1.7784 WP_000121509.1.78352 WP_000121509.1.78959 WP_000121509.1.79531 WP_000121509.1.79977 WP_000121509.1.80045 WP_000121509.1.81041 WP_000121509.1.81084 WP_000121509.1.81568 WP_000121509.1.81798 WP_000121509.1.82692 WP_000121509.1.83280 WP_000121509.1.83806 WP_000121509.1.84814 WP_000121509.1.84872 WP_000121509.1.84879 WP_000121509.1.86466 WP_000121509.1.87220 WP_000121509.1.87276 WP_000121509.1.87376 WP_000121509.1.87651 WP_000121509.1.87891 WP_000121509.1.89764 WP_000121509.1.91282 WP_000121509.1.91312 WP_000121509.1.91331 WP_000121509.1.9166 WP_000121509.1.91984 WP_000121509.1.92646 WP_000121509.1.92786 WP_000121509.1.92842 WP_000121509.1.92936 WP_000121509.1.93118 WP_000121509.1.94071 WP_000121509.1.95133 WP_000121509.1.96731 WP_000121509.1.99073 CP000026|CDS_3196713-3198731 FM200053|CDS_3192387-3194405 gi|56415158|ref|YP_152233.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]