SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|537442426|ref|YP_008485003.1| from Staphylococcus aureus subsp. aureus 6850

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|537442426|ref|YP_008485003.1|
Domain Number 1 Region: 18-365
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.29e-104
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.000000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|537442426|ref|YP_008485003.1|
Sequence length 370
Comment pyruvate dehydrogenase complex E1 component, alpha subunit PdhA [Staphylococcus aureus subsp. aureus 6850]
Sequence
MAPKLQAQFDAVKVLNDTQSKFEMVQILDENGNVVNEDLVPDLTDEQLVELMERMVWTRI
LDQRSISLNRQGRLGFYAPTAGQEASQLASQYALEKEDYILPGYRDVPQIIWHGLPLTEA
FLFSRGHFKGNQFPEGVNALSPQIIIGAQYIQAAGVAFALKKRGKNAVAITYTGDGGSSQ
GDFYEGINFAAAYKAPAIFVIQNNNYAISTPRSKQTAAETLAQKAIAVGIPGIQVDGMDA
LAVYQATKEARDRAVAGEGPTLIETMTYRYGPHTMAGDDPTRYRTSDEDAEWEKKDPLVR
FRKFLENKGLWNEDKENEVIERAKADIKAAIKEADNTEKQTVTSLMEIMYEDMPQNLAEQ
YEIYKEKESK
Download sequence
Identical sequences A0A0D1GLU8 A0A0E1AF40 A0A0E1VKH3 A0A0H2XHD5 A0A0H3K7D7 A0A1E8WQ34 A0A2H5AMU0 P60089 P60090 Q2FZG4 Q5HGZ1 Q6GAC1 Q820A6 T1Y8D2 W8TMM6
gi|387780206|ref|YP_005755004.1| gi|87160754|ref|YP_493691.1| gi|470198932|ref|YP_007585332.1| gi|148267586|ref|YP_001246529.1| gi|161509276|ref|YP_001574935.1| gi|21282705|ref|NP_645793.1| gi|470218702|ref|YP_007619096.1| gi|387150235|ref|YP_005741799.1| gi|387142705|ref|YP_005731098.1| gi|15924083|ref|NP_371617.1| gi|57651702|ref|YP_185966.1| gi|384861688|ref|YP_005744408.1| gi|470222523|ref|YP_007621080.1| gi|537442426|ref|YP_008485003.1| 158878.SAV1093 158879.SA0943-1 196620.MW0976 282459.SAS1028 359786.SaurJH9_1153 359787.SaurJH1_1175 418127.SAHV_1085 426430.NWMN_0959 451515.SAUSA300_0993 451516.USA300HOU_1036 681288.SAAV_1058 93061.SAOUHSC_01040 93062.SACOL1102 gi|386830629|ref|YP_006237283.1| gi|379020800|ref|YP_005297462.1| gi|150393641|ref|YP_001316316.1| gi|385781321|ref|YP_005757492.1| gi|470196965|ref|YP_007583366.1| gi|545637432|ref|YP_008587608.1| gi|537460763|ref|YP_008491203.1| gi|470194999|ref|YP_007581351.1| gi|156979416|ref|YP_001441675.1| gi|384864320|ref|YP_005749679.1| gi|479329005|ref|YP_007868064.1| gi|269202704|ref|YP_003281973.1| gi|545634505|ref|YP_008585075.1| gi|151221171|ref|YP_001331993.1| gi|379014286|ref|YP_005290522.1| gi|384869626|ref|YP_005752340.1| gi|470193035|ref|YP_007579388.1| gi|470224490|ref|YP_007623069.1| jgi|Aspzo1|67858|e_gw1.9.132.1 gi|521211820|ref|YP_008168166.1| WP_000035320.1.100013 WP_000035320.1.100041 WP_000035320.1.100049 WP_000035320.1.100057 WP_000035320.1.10006 WP_000035320.1.100067 WP_000035320.1.100072 WP_000035320.1.100084 WP_000035320.1.100088 WP_000035320.1.100090 WP_000035320.1.100094 WP_000035320.1.100096 WP_000035320.1.100122 WP_000035320.1.10014 WP_000035320.1.100154 WP_000035320.1.100171 WP_000035320.1.100180 WP_000035320.1.100184 WP_000035320.1.100189 WP_000035320.1.100235 WP_000035320.1.100298 WP_000035320.1.100307 WP_000035320.1.100310 WP_000035320.1.10032 WP_000035320.1.100335 WP_000035320.1.100352 WP_000035320.1.100357 WP_000035320.1.100391 WP_000035320.1.100399 WP_000035320.1.10041 WP_000035320.1.10046 WP_000035320.1.100464 WP_000035320.1.100507 WP_000035320.1.100527 WP_000035320.1.100535 WP_000035320.1.100560 WP_000035320.1.100562 WP_000035320.1.100582 WP_000035320.1.100596 WP_000035320.1.100604 WP_000035320.1.100612 WP_000035320.1.100613 WP_000035320.1.100618 WP_000035320.1.100631 WP_000035320.1.100647 WP_000035320.1.100665 WP_000035320.1.100668 WP_000035320.1.100693 WP_000035320.1.100699 WP_000035320.1.100719 WP_000035320.1.100761 WP_000035320.1.100768 WP_000035320.1.100785 WP_000035320.1.100823 WP_000035320.1.100832 WP_000035320.1.100834 WP_000035320.1.10085 WP_000035320.1.100860 WP_000035320.1.100888 WP_000035320.1.1009 WP_000035320.1.100903 WP_000035320.1.100920 WP_000035320.1.100922 WP_000035320.1.100934 WP_000035320.1.100956 WP_000035320.1.100963 WP_000035320.1.100981 WP_000035320.1.100986 WP_000035320.1.100987 WP_000035320.1.101002 WP_000035320.1.101017 WP_000035320.1.101019 WP_000035320.1.101023 WP_000035320.1.101027 WP_000035320.1.101072 WP_000035320.1.101084 WP_000035320.1.101103 WP_000035320.1.10111 WP_000035320.1.101160 WP_000035320.1.101177 WP_000035320.1.101192 WP_000035320.1.101240 WP_000035320.1.101262 WP_000035320.1.101266 WP_000035320.1.101298 WP_000035320.1.101327 WP_000035320.1.101329 WP_000035320.1.101330 WP_000035320.1.101355 WP_000035320.1.101375 WP_000035320.1.101379 WP_000035320.1.101393 WP_000035320.1.101402 WP_000035320.1.101406 WP_000035320.1.101414 WP_000035320.1.101440 WP_000035320.1.101441 WP_000035320.1.10148 WP_000035320.1.101490 WP_000035320.1.1015 WP_000035320.1.101505 WP_000035320.1.101511 WP_000035320.1.101566 WP_000035320.1.101567 WP_000035320.1.101570 WP_000035320.1.101598 WP_000035320.1.101615 WP_000035320.1.101617 WP_000035320.1.101619 WP_000035320.1.101627 WP_000035320.1.101645 WP_000035320.1.10165 WP_000035320.1.101657 WP_000035320.1.10166 WP_000035320.1.101704 WP_000035320.1.101716 WP_000035320.1.101725 WP_000035320.1.101728 WP_000035320.1.101731 WP_000035320.1.101745 WP_000035320.1.101757 WP_000035320.1.101778 WP_000035320.1.101779 WP_000035320.1.101788 WP_000035320.1.101813 WP_000035320.1.101824 WP_000035320.1.101831 WP_000035320.1.101902 WP_000035320.1.101906 WP_000035320.1.101921 WP_000035320.1.101922 WP_000035320.1.101943 WP_000035320.1.102065 WP_000035320.1.102066 WP_000035320.1.102070 WP_000035320.1.102096 WP_000035320.1.102123 WP_000035320.1.102132 WP_000035320.1.10214 WP_000035320.1.1022 WP_000035320.1.10232 WP_000035320.1.10238 WP_000035320.1.10240 WP_000035320.1.10244 WP_000035320.1.10249 WP_000035320.1.10274 WP_000035320.1.10292 WP_000035320.1.10294 WP_000035320.1.10301 WP_000035320.1.10306 WP_000035320.1.1032 WP_000035320.1.10321 WP_000035320.1.10355 WP_000035320.1.10397 WP_000035320.1.1043 WP_000035320.1.10431 WP_000035320.1.10436 WP_000035320.1.10450 WP_000035320.1.10478 WP_000035320.1.10481 WP_000035320.1.10486 WP_000035320.1.10503 WP_000035320.1.10526 WP_000035320.1.10542 WP_000035320.1.10543 WP_000035320.1.10565 WP_000035320.1.10583 WP_000035320.1.10624 WP_000035320.1.10644 WP_000035320.1.10664 WP_000035320.1.10679 WP_000035320.1.10707 WP_000035320.1.10726 WP_000035320.1.10742 WP_000035320.1.10749 WP_000035320.1.10751 WP_000035320.1.1077 WP_000035320.1.10823 WP_000035320.1.10841 WP_000035320.1.10858 WP_000035320.1.10917 WP_000035320.1.10919 WP_000035320.1.10928 WP_000035320.1.10942 WP_000035320.1.10950 WP_000035320.1.10965 WP_000035320.1.1097 WP_000035320.1.10976 WP_000035320.1.10979 WP_000035320.1.10985 WP_000035320.1.10986 WP_000035320.1.11001 WP_000035320.1.11067 WP_000035320.1.11069 WP_000035320.1.11073 WP_000035320.1.11074 WP_000035320.1.11084 WP_000035320.1.11129 WP_000035320.1.1115 WP_000035320.1.11162 WP_000035320.1.11184 WP_000035320.1.1120 WP_000035320.1.11202 WP_000035320.1.11220 WP_000035320.1.11228 WP_000035320.1.11261 WP_000035320.1.11282 WP_000035320.1.11286 WP_000035320.1.11287 WP_000035320.1.11294 WP_000035320.1.11312 WP_000035320.1.11322 WP_000035320.1.11333 WP_000035320.1.11348 WP_000035320.1.11353 WP_000035320.1.1136 WP_000035320.1.11365 WP_000035320.1.11377 WP_000035320.1.11391 WP_000035320.1.11403 WP_000035320.1.11407 WP_000035320.1.11434 WP_000035320.1.11441 WP_000035320.1.11447 WP_000035320.1.11451 WP_000035320.1.11463 WP_000035320.1.11488 WP_000035320.1.11492 WP_000035320.1.11494 WP_000035320.1.1151 WP_000035320.1.1152 WP_000035320.1.11525 WP_000035320.1.11540 WP_000035320.1.11556 WP_000035320.1.11558 WP_000035320.1.11580 WP_000035320.1.11592 WP_000035320.1.11611 WP_000035320.1.11625 WP_000035320.1.11646 WP_000035320.1.11655 WP_000035320.1.11663 WP_000035320.1.11665 WP_000035320.1.11692 WP_000035320.1.117 WP_000035320.1.1171 WP_000035320.1.11719 WP_000035320.1.11720 WP_000035320.1.11723 WP_000035320.1.11730 WP_000035320.1.11736 WP_000035320.1.11768 WP_000035320.1.11794 WP_000035320.1.11795 WP_000035320.1.11816 WP_000035320.1.11829 WP_000035320.1.11837 WP_000035320.1.11884 WP_000035320.1.11904 WP_000035320.1.11969 WP_000035320.1.11991 WP_000035320.1.12005 WP_000035320.1.12019 WP_000035320.1.12026 WP_000035320.1.12029 WP_000035320.1.12042 WP_000035320.1.1205 WP_000035320.1.12073 WP_000035320.1.12098 WP_000035320.1.1210 WP_000035320.1.12123 WP_000035320.1.1213 WP_000035320.1.12149 WP_000035320.1.12175 WP_000035320.1.12179 WP_000035320.1.12194 WP_000035320.1.12201 WP_000035320.1.12226 WP_000035320.1.12234 WP_000035320.1.12256 WP_000035320.1.12272 WP_000035320.1.12297 WP_000035320.1.12328 WP_000035320.1.12330 WP_000035320.1.12361 WP_000035320.1.12366 WP_000035320.1.12436 WP_000035320.1.12447 WP_000035320.1.12498 WP_000035320.1.12508 WP_000035320.1.12516 WP_000035320.1.1252 WP_000035320.1.1257 WP_000035320.1.12598 WP_000035320.1.12618 WP_000035320.1.12639 WP_000035320.1.12668 WP_000035320.1.12685 WP_000035320.1.12711 WP_000035320.1.12715 WP_000035320.1.12737 WP_000035320.1.1276 WP_000035320.1.12770 WP_000035320.1.12771 WP_000035320.1.12772 WP_000035320.1.12780 WP_000035320.1.12788 WP_000035320.1.12822 WP_000035320.1.12829 WP_000035320.1.12833 WP_000035320.1.12845 WP_000035320.1.12858 WP_000035320.1.12862 WP_000035320.1.12884 WP_000035320.1.12886 WP_000035320.1.12903 WP_000035320.1.12918 WP_000035320.1.12920 WP_000035320.1.12937 WP_000035320.1.12977 WP_000035320.1.13013 WP_000035320.1.13039 WP_000035320.1.13062 WP_000035320.1.13072 WP_000035320.1.13091 WP_000035320.1.13104 WP_000035320.1.13154 WP_000035320.1.13164 WP_000035320.1.13169 WP_000035320.1.13189 WP_000035320.1.13243 WP_000035320.1.13250 WP_000035320.1.13303 WP_000035320.1.13317 WP_000035320.1.13322 WP_000035320.1.13326 WP_000035320.1.13355 WP_000035320.1.13379 WP_000035320.1.13405 WP_000035320.1.13448 WP_000035320.1.13468 WP_000035320.1.1347 WP_000035320.1.13486 WP_000035320.1.13501 WP_000035320.1.13514 WP_000035320.1.13531 WP_000035320.1.13532 WP_000035320.1.1355 WP_000035320.1.13554 WP_000035320.1.13556 WP_000035320.1.13557 WP_000035320.1.13568 WP_000035320.1.13598 WP_000035320.1.13612 WP_000035320.1.13617 WP_000035320.1.13654 WP_000035320.1.13668 WP_000035320.1.13670 WP_000035320.1.13679 WP_000035320.1.13680 WP_000035320.1.13683 WP_000035320.1.13696 WP_000035320.1.13726 WP_000035320.1.13727 WP_000035320.1.13733 WP_000035320.1.13734 WP_000035320.1.1374 WP_000035320.1.1375 WP_000035320.1.13755 WP_000035320.1.13757 WP_000035320.1.13772 WP_000035320.1.13804 WP_000035320.1.13805 WP_000035320.1.13831 WP_000035320.1.13879 WP_000035320.1.13897 WP_000035320.1.13914 WP_000035320.1.13933 WP_000035320.1.13940 WP_000035320.1.13947 WP_000035320.1.13983 WP_000035320.1.13986 WP_000035320.1.13987 WP_000035320.1.14010 WP_000035320.1.14025 WP_000035320.1.14034 WP_000035320.1.14071 WP_000035320.1.14076 WP_000035320.1.14097 WP_000035320.1.14112 WP_000035320.1.14143 WP_000035320.1.14153 WP_000035320.1.14163 WP_000035320.1.1420 WP_000035320.1.14233 WP_000035320.1.1425 WP_000035320.1.1426 WP_000035320.1.1429 WP_000035320.1.14302 WP_000035320.1.14342 WP_000035320.1.14355 WP_000035320.1.14358 WP_000035320.1.14364 WP_000035320.1.14365 WP_000035320.1.14366 WP_000035320.1.14372 WP_000035320.1.14394 WP_000035320.1.14412 WP_000035320.1.14418 WP_000035320.1.14475 WP_000035320.1.1457 WP_000035320.1.14577 WP_000035320.1.14596 WP_000035320.1.14639 WP_000035320.1.14666 WP_000035320.1.1468 WP_000035320.1.14696 WP_000035320.1.147 WP_000035320.1.1471 WP_000035320.1.14734 WP_000035320.1.14744 WP_000035320.1.1477 WP_000035320.1.14774 WP_000035320.1.14782 WP_000035320.1.14787 WP_000035320.1.14790 WP_000035320.1.14809 WP_000035320.1.14823 WP_000035320.1.14825 WP_000035320.1.14846 WP_000035320.1.14866 WP_000035320.1.14869 WP_000035320.1.14874 WP_000035320.1.14888 WP_000035320.1.14902 WP_000035320.1.14924 WP_000035320.1.14967 WP_000035320.1.14970 WP_000035320.1.14987 WP_000035320.1.15000 WP_000035320.1.15015 WP_000035320.1.15022 WP_000035320.1.15039 WP_000035320.1.15091 WP_000035320.1.15098 WP_000035320.1.15108 WP_000035320.1.15173 WP_000035320.1.15182 WP_000035320.1.15185 WP_000035320.1.1520 WP_000035320.1.15201 WP_000035320.1.15228 WP_000035320.1.15241 WP_000035320.1.15263 WP_000035320.1.15268 WP_000035320.1.15269 WP_000035320.1.15278 WP_000035320.1.15294 WP_000035320.1.15296 WP_000035320.1.15329 WP_000035320.1.15389 WP_000035320.1.15399 WP_000035320.1.15403 WP_000035320.1.15409 WP_000035320.1.15421 WP_000035320.1.15438 WP_000035320.1.1545 WP_000035320.1.15478 WP_000035320.1.15489 WP_000035320.1.15505 WP_000035320.1.15507 WP_000035320.1.15519 WP_000035320.1.15524 WP_000035320.1.15533 WP_000035320.1.15544 WP_000035320.1.15546 WP_000035320.1.15554 WP_000035320.1.15572 WP_000035320.1.1558 WP_000035320.1.15590 WP_000035320.1.15601 WP_000035320.1.1562 WP_000035320.1.1564 WP_000035320.1.15687 WP_000035320.1.1569 WP_000035320.1.15691 WP_000035320.1.15706 WP_000035320.1.15722 WP_000035320.1.15753 WP_000035320.1.15785 WP_000035320.1.1579 WP_000035320.1.15812 WP_000035320.1.15818 WP_000035320.1.1583 WP_000035320.1.15838 WP_000035320.1.15883 WP_000035320.1.15892 WP_000035320.1.15897 WP_000035320.1.15898 WP_000035320.1.159 WP_000035320.1.15920 WP_000035320.1.15921 WP_000035320.1.15925 WP_000035320.1.15928 WP_000035320.1.15939 WP_000035320.1.15957 WP_000035320.1.15972 WP_000035320.1.1599 WP_000035320.1.1600 WP_000035320.1.16018 WP_000035320.1.1606 WP_000035320.1.16068 WP_000035320.1.16095 WP_000035320.1.16096 WP_000035320.1.16098 WP_000035320.1.16112 WP_000035320.1.16114 WP_000035320.1.16173 WP_000035320.1.16213 WP_000035320.1.16223 WP_000035320.1.1623 WP_000035320.1.16237 WP_000035320.1.16251 WP_000035320.1.16265 WP_000035320.1.16283 WP_000035320.1.16362 WP_000035320.1.16395 WP_000035320.1.16417 WP_000035320.1.16433 WP_000035320.1.16455 WP_000035320.1.16458 WP_000035320.1.16467 WP_000035320.1.16554 WP_000035320.1.16569 WP_000035320.1.16603 WP_000035320.1.16606 WP_000035320.1.16617 WP_000035320.1.1662 WP_000035320.1.16628 WP_000035320.1.16632 WP_000035320.1.16639 WP_000035320.1.16649 WP_000035320.1.1665 WP_000035320.1.16651 WP_000035320.1.16653 WP_000035320.1.16664 WP_000035320.1.16672 WP_000035320.1.16679 WP_000035320.1.16684 WP_000035320.1.16688 WP_000035320.1.16693 WP_000035320.1.16703 WP_000035320.1.16747 WP_000035320.1.16757 WP_000035320.1.16761 WP_000035320.1.16762 WP_000035320.1.16768 WP_000035320.1.16770 WP_000035320.1.16776 WP_000035320.1.16794 WP_000035320.1.16815 WP_000035320.1.16824 WP_000035320.1.16833 WP_000035320.1.16880 WP_000035320.1.16882 WP_000035320.1.16892 WP_000035320.1.16920 WP_000035320.1.16925 WP_000035320.1.16936 WP_000035320.1.16938 WP_000035320.1.16946 WP_000035320.1.16986 WP_000035320.1.170 WP_000035320.1.17012 WP_000035320.1.17038 WP_000035320.1.17046 WP_000035320.1.17050 WP_000035320.1.17080 WP_000035320.1.17104 WP_000035320.1.17122 WP_000035320.1.17132 WP_000035320.1.17137 WP_000035320.1.17156 WP_000035320.1.17157 WP_000035320.1.17169 WP_000035320.1.17180 WP_000035320.1.17193 WP_000035320.1.17200 WP_000035320.1.17210 WP_000035320.1.17231 WP_000035320.1.17234 WP_000035320.1.17240 WP_000035320.1.17248 WP_000035320.1.17249 WP_000035320.1.17256 WP_000035320.1.17289 WP_000035320.1.1729 WP_000035320.1.17320 WP_000035320.1.17327 WP_000035320.1.1740 WP_000035320.1.1741 WP_000035320.1.17419 WP_000035320.1.17450 WP_000035320.1.17454 WP_000035320.1.17456 WP_000035320.1.17475 WP_000035320.1.17485 WP_000035320.1.17520 WP_000035320.1.17526 WP_000035320.1.17531 WP_000035320.1.1756 WP_000035320.1.17581 WP_000035320.1.17590 WP_000035320.1.17628 WP_000035320.1.1765 WP_000035320.1.17650 WP_000035320.1.17651 WP_000035320.1.17657 WP_000035320.1.17658 WP_000035320.1.17666 WP_000035320.1.17671 WP_000035320.1.17676 WP_000035320.1.1771 WP_000035320.1.17720 WP_000035320.1.17725 WP_000035320.1.17737 WP_000035320.1.17770 WP_000035320.1.17796 WP_000035320.1.17832 WP_000035320.1.17834 WP_000035320.1.17835 WP_000035320.1.17838 WP_000035320.1.17845 WP_000035320.1.17847 WP_000035320.1.17853 WP_000035320.1.17859 WP_000035320.1.1787 WP_000035320.1.17876 WP_000035320.1.17882 WP_000035320.1.17922 WP_000035320.1.17929 WP_000035320.1.17951 WP_000035320.1.17966 WP_000035320.1.18011 WP_000035320.1.18016 WP_000035320.1.18035 WP_000035320.1.18069 WP_000035320.1.18074 WP_000035320.1.18105 WP_000035320.1.18113 WP_000035320.1.18140 WP_000035320.1.18153 WP_000035320.1.18197 WP_000035320.1.18203 WP_000035320.1.18237 WP_000035320.1.18248 WP_000035320.1.18261 WP_000035320.1.18273 WP_000035320.1.18283 WP_000035320.1.18288 WP_000035320.1.1829 WP_000035320.1.18290 WP_000035320.1.18301 WP_000035320.1.18309 WP_000035320.1.18310 WP_000035320.1.18320 WP_000035320.1.18346 WP_000035320.1.1835 WP_000035320.1.18360 WP_000035320.1.18412 WP_000035320.1.18429 WP_000035320.1.18437 WP_000035320.1.18451 WP_000035320.1.18466 WP_000035320.1.1847 WP_000035320.1.18487 WP_000035320.1.18497 WP_000035320.1.185 WP_000035320.1.18504 WP_000035320.1.1851 WP_000035320.1.18516 WP_000035320.1.18527 WP_000035320.1.18529 WP_000035320.1.18538 WP_000035320.1.18539 WP_000035320.1.18545 WP_000035320.1.18560 WP_000035320.1.18562 WP_000035320.1.18566 WP_000035320.1.18567 WP_000035320.1.18570 WP_000035320.1.18590 WP_000035320.1.18591 WP_000035320.1.18611 WP_000035320.1.18627 WP_000035320.1.18632 WP_000035320.1.18658 WP_000035320.1.18668 WP_000035320.1.18679 WP_000035320.1.18741 WP_000035320.1.18758 WP_000035320.1.18763 WP_000035320.1.18774 WP_000035320.1.18777 WP_000035320.1.18779 WP_000035320.1.18792 WP_000035320.1.18809 WP_000035320.1.18819 WP_000035320.1.18830 WP_000035320.1.18834 WP_000035320.1.18836 WP_000035320.1.18879 WP_000035320.1.18882 WP_000035320.1.18918 WP_000035320.1.18938 WP_000035320.1.18965 WP_000035320.1.18968 WP_000035320.1.18974 WP_000035320.1.18987 WP_000035320.1.18996 WP_000035320.1.19009 WP_000035320.1.1901 WP_000035320.1.19022 WP_000035320.1.19027 WP_000035320.1.19052 WP_000035320.1.19082 WP_000035320.1.19149 WP_000035320.1.19179 WP_000035320.1.192 WP_000035320.1.19259 WP_000035320.1.19272 WP_000035320.1.19301 WP_000035320.1.19322 WP_000035320.1.19365 WP_000035320.1.19386 WP_000035320.1.19390 WP_000035320.1.19399 WP_000035320.1.19430 WP_000035320.1.19444 WP_000035320.1.19450 WP_000035320.1.19455 WP_000035320.1.19497 WP_000035320.1.19509 WP_000035320.1.19515 WP_000035320.1.19537 WP_000035320.1.19555 WP_000035320.1.19575 WP_000035320.1.19611 WP_000035320.1.1964 WP_000035320.1.19643 WP_000035320.1.19701 WP_000035320.1.19717 WP_000035320.1.19725 WP_000035320.1.19732 WP_000035320.1.19733 WP_000035320.1.1974 WP_000035320.1.1975 WP_000035320.1.19765 WP_000035320.1.19775 WP_000035320.1.19788 WP_000035320.1.19792 WP_000035320.1.19801 WP_000035320.1.19807 WP_000035320.1.19848 WP_000035320.1.19853 WP_000035320.1.19891 WP_000035320.1.19905 WP_000035320.1.19912 WP_000035320.1.19921 WP_000035320.1.19968 WP_000035320.1.19977 WP_000035320.1.19980 WP_000035320.1.19981 WP_000035320.1.19982 WP_000035320.1.2 WP_000035320.1.20006 WP_000035320.1.20049 WP_000035320.1.20052 WP_000035320.1.20057 WP_000035320.1.2007 WP_000035320.1.20078 WP_000035320.1.2008 WP_000035320.1.20090 WP_000035320.1.20100 WP_000035320.1.20101 WP_000035320.1.2013 WP_000035320.1.20155 WP_000035320.1.20156 WP_000035320.1.20160 WP_000035320.1.20161 WP_000035320.1.20167 WP_000035320.1.20177 WP_000035320.1.20191 WP_000035320.1.20210 WP_000035320.1.20214 WP_000035320.1.20219 WP_000035320.1.20221 WP_000035320.1.20235 WP_000035320.1.2025 WP_000035320.1.2029 WP_000035320.1.20324 WP_000035320.1.20340 WP_000035320.1.20354 WP_000035320.1.20358 WP_000035320.1.20386 WP_000035320.1.20394 WP_000035320.1.20398 WP_000035320.1.20399 WP_000035320.1.20411 WP_000035320.1.20447 WP_000035320.1.20473 WP_000035320.1.20479 WP_000035320.1.20487 WP_000035320.1.20500 WP_000035320.1.20512 WP_000035320.1.20554 WP_000035320.1.2056 WP_000035320.1.20574 WP_000035320.1.20579 WP_000035320.1.20585 WP_000035320.1.20598 WP_000035320.1.20618 WP_000035320.1.20649 WP_000035320.1.20661 WP_000035320.1.20690 WP_000035320.1.20698 WP_000035320.1.20736 WP_000035320.1.20772 WP_000035320.1.20821 WP_000035320.1.20833 WP_000035320.1.20838 WP_000035320.1.20846 WP_000035320.1.20860 WP_000035320.1.20866 WP_000035320.1.20867 WP_000035320.1.20878 WP_000035320.1.20906 WP_000035320.1.20913 WP_000035320.1.20922 WP_000035320.1.20935 WP_000035320.1.20939 WP_000035320.1.20971 WP_000035320.1.20975 WP_000035320.1.21009 WP_000035320.1.21013 WP_000035320.1.21015 WP_000035320.1.21031 WP_000035320.1.21036 WP_000035320.1.21054 WP_000035320.1.21056 WP_000035320.1.21066 WP_000035320.1.21078 WP_000035320.1.21080 WP_000035320.1.21081 WP_000035320.1.21111 WP_000035320.1.21140 WP_000035320.1.21154 WP_000035320.1.21183 WP_000035320.1.21222 WP_000035320.1.21257 WP_000035320.1.21259 WP_000035320.1.21272 WP_000035320.1.2128 WP_000035320.1.2129 WP_000035320.1.21312 WP_000035320.1.21313 WP_000035320.1.21314 WP_000035320.1.21339 WP_000035320.1.2135 WP_000035320.1.21356 WP_000035320.1.21359 WP_000035320.1.21375 WP_000035320.1.21379 WP_000035320.1.21386 WP_000035320.1.21402 WP_000035320.1.21412 WP_000035320.1.21416 WP_000035320.1.21449 WP_000035320.1.21458 WP_000035320.1.21464 WP_000035320.1.21465 WP_000035320.1.21480 WP_000035320.1.21505 WP_000035320.1.21511 WP_000035320.1.2154 WP_000035320.1.21572 WP_000035320.1.21583 WP_000035320.1.21589 WP_000035320.1.2159 WP_000035320.1.21601 WP_000035320.1.21621 WP_000035320.1.21636 WP_000035320.1.21679 WP_000035320.1.21712 WP_000035320.1.21719 WP_000035320.1.21724 WP_000035320.1.21746 WP_000035320.1.2178 WP_000035320.1.21787 WP_000035320.1.21820 WP_000035320.1.21828 WP_000035320.1.21830 WP_000035320.1.21890 WP_000035320.1.21900 WP_000035320.1.21901 WP_000035320.1.21985 WP_000035320.1.21988 WP_000035320.1.2200 WP_000035320.1.22000 WP_000035320.1.22011 WP_000035320.1.22033 WP_000035320.1.22038 WP_000035320.1.22045 WP_000035320.1.22049 WP_000035320.1.22065 WP_000035320.1.22111 WP_000035320.1.22163 WP_000035320.1.22164 WP_000035320.1.22165 WP_000035320.1.22170 WP_000035320.1.22174 WP_000035320.1.22177 WP_000035320.1.22180 WP_000035320.1.22197 WP_000035320.1.22227 WP_000035320.1.22246 WP_000035320.1.22302 WP_000035320.1.22307 WP_000035320.1.22332 WP_000035320.1.22344 WP_000035320.1.22351 WP_000035320.1.22367 WP_000035320.1.22419 WP_000035320.1.22426 WP_000035320.1.22441 WP_000035320.1.22493 WP_000035320.1.22498 WP_000035320.1.22526 WP_000035320.1.22531 WP_000035320.1.22533 WP_000035320.1.22547 WP_000035320.1.22551 WP_000035320.1.22559 WP_000035320.1.22650 WP_000035320.1.22657 WP_000035320.1.22702 WP_000035320.1.22709 WP_000035320.1.22714 WP_000035320.1.22730 WP_000035320.1.22731 WP_000035320.1.22764 WP_000035320.1.22790 WP_000035320.1.22792 WP_000035320.1.2280 WP_000035320.1.22803 WP_000035320.1.22808 WP_000035320.1.22811 WP_000035320.1.22826 WP_000035320.1.22843 WP_000035320.1.22859 WP_000035320.1.22861 WP_000035320.1.22869 WP_000035320.1.22924 WP_000035320.1.22969 WP_000035320.1.22983 WP_000035320.1.22984 WP_000035320.1.22994 WP_000035320.1.23004 WP_000035320.1.23008 WP_000035320.1.23012 WP_000035320.1.23048 WP_000035320.1.23061 WP_000035320.1.23082 WP_000035320.1.23103 WP_000035320.1.23121 WP_000035320.1.23133 WP_000035320.1.23146 WP_000035320.1.23152 WP_000035320.1.23161 WP_000035320.1.23185 WP_000035320.1.23194 WP_000035320.1.23197 WP_000035320.1.23222 WP_000035320.1.23228 WP_000035320.1.23238 WP_000035320.1.23251 WP_000035320.1.2327 WP_000035320.1.23288 WP_000035320.1.23304 WP_000035320.1.23381 WP_000035320.1.23413 WP_000035320.1.23420 WP_000035320.1.23431 WP_000035320.1.23439 WP_000035320.1.23450 WP_000035320.1.23476 WP_000035320.1.23489 WP_000035320.1.23491 WP_000035320.1.23517 WP_000035320.1.23531 WP_000035320.1.23541 WP_000035320.1.23544 WP_000035320.1.23572 WP_000035320.1.23580 WP_000035320.1.23586 WP_000035320.1.23613 WP_000035320.1.23617 WP_000035320.1.23626 WP_000035320.1.23630 WP_000035320.1.23644 WP_000035320.1.2365 WP_000035320.1.23671 WP_000035320.1.23690 WP_000035320.1.23708 WP_000035320.1.23710 WP_000035320.1.23730 WP_000035320.1.23809 WP_000035320.1.23822 WP_000035320.1.23849 WP_000035320.1.2389 WP_000035320.1.23900 WP_000035320.1.23902 WP_000035320.1.23907 WP_000035320.1.23926 WP_000035320.1.23935 WP_000035320.1.23944 WP_000035320.1.23972 WP_000035320.1.23995 WP_000035320.1.23998 WP_000035320.1.24000 WP_000035320.1.24081 WP_000035320.1.24129 WP_000035320.1.24148 WP_000035320.1.24154 WP_000035320.1.24167 WP_000035320.1.24174 WP_000035320.1.24207 WP_000035320.1.24213 WP_000035320.1.24226 WP_000035320.1.2423 WP_000035320.1.24241 WP_000035320.1.2427 WP_000035320.1.24276 WP_000035320.1.24277 WP_000035320.1.24279 WP_000035320.1.24286 WP_000035320.1.24302 WP_000035320.1.2434 WP_000035320.1.24343 WP_000035320.1.24364 WP_000035320.1.24365 WP_000035320.1.24416 WP_000035320.1.24418 WP_000035320.1.2442 WP_000035320.1.24437 WP_000035320.1.24443 WP_000035320.1.24478 WP_000035320.1.2450 WP_000035320.1.24503 WP_000035320.1.24516 WP_000035320.1.24519 WP_000035320.1.24569 WP_000035320.1.24572 WP_000035320.1.2458 WP_000035320.1.24589 WP_000035320.1.24596 WP_000035320.1.24602 WP_000035320.1.24617 WP_000035320.1.24625 WP_000035320.1.24631 WP_000035320.1.24654 WP_000035320.1.24674 WP_000035320.1.24679 WP_000035320.1.24681 WP_000035320.1.24684 WP_000035320.1.24685 WP_000035320.1.24702 WP_000035320.1.24711 WP_000035320.1.24714 WP_000035320.1.24745 WP_000035320.1.24781 WP_000035320.1.2480 WP_000035320.1.24802 WP_000035320.1.24823 WP_000035320.1.24834 WP_000035320.1.24855 WP_000035320.1.24891 WP_000035320.1.24903 WP_000035320.1.24918 WP_000035320.1.24937 WP_000035320.1.2497 WP_000035320.1.24996 WP_000035320.1.25001 WP_000035320.1.2501 WP_000035320.1.25012 WP_000035320.1.2506 WP_000035320.1.25070 WP_000035320.1.25083 WP_000035320.1.25092 WP_000035320.1.25095 WP_000035320.1.25098 WP_000035320.1.25120 WP_000035320.1.25145 WP_000035320.1.25167 WP_000035320.1.25170 WP_000035320.1.25209 WP_000035320.1.25216 WP_000035320.1.25221 WP_000035320.1.25262 WP_000035320.1.25288 WP_000035320.1.25331 WP_000035320.1.25341 WP_000035320.1.25345 WP_000035320.1.25361 WP_000035320.1.25438 WP_000035320.1.2544 WP_000035320.1.25459 WP_000035320.1.25469 WP_000035320.1.25479 WP_000035320.1.25511 WP_000035320.1.2552 WP_000035320.1.25567 WP_000035320.1.25569 WP_000035320.1.25593 WP_000035320.1.25595 WP_000035320.1.25621 WP_000035320.1.25633 WP_000035320.1.25634 WP_000035320.1.25651 WP_000035320.1.25721 WP_000035320.1.25732 WP_000035320.1.25737 WP_000035320.1.25758 WP_000035320.1.25770 WP_000035320.1.25772 WP_000035320.1.25779 WP_000035320.1.2579 WP_000035320.1.25801 WP_000035320.1.25802 WP_000035320.1.25820 WP_000035320.1.25840 WP_000035320.1.25867 WP_000035320.1.25868 WP_000035320.1.25881 WP_000035320.1.25891 WP_000035320.1.25910 WP_000035320.1.2592 WP_000035320.1.25924 WP_000035320.1.25929 WP_000035320.1.2593 WP_000035320.1.25955 WP_000035320.1.26006 WP_000035320.1.26012 WP_000035320.1.26015 WP_000035320.1.26039 WP_000035320.1.26050 WP_000035320.1.26058 WP_000035320.1.2608 WP_000035320.1.26086 WP_000035320.1.26143 WP_000035320.1.26169 WP_000035320.1.262 WP_000035320.1.2621 WP_000035320.1.26225 WP_000035320.1.26226 WP_000035320.1.26255 WP_000035320.1.26266 WP_000035320.1.26271 WP_000035320.1.26283 WP_000035320.1.26293 WP_000035320.1.26298 WP_000035320.1.26306 WP_000035320.1.26307 WP_000035320.1.26314 WP_000035320.1.26318 WP_000035320.1.2633 WP_000035320.1.26340 WP_000035320.1.26346 WP_000035320.1.26354 WP_000035320.1.26359 WP_000035320.1.26364 WP_000035320.1.26370 WP_000035320.1.26399 WP_000035320.1.26404 WP_000035320.1.26405 WP_000035320.1.26424 WP_000035320.1.2643 WP_000035320.1.26431 WP_000035320.1.26481 WP_000035320.1.26506 WP_000035320.1.26533 WP_000035320.1.2656 WP_000035320.1.2658 WP_000035320.1.2661 WP_000035320.1.2664 WP_000035320.1.26662 WP_000035320.1.26663 WP_000035320.1.26664 WP_000035320.1.26692 WP_000035320.1.26726 WP_000035320.1.2673 WP_000035320.1.26733 WP_000035320.1.2674 WP_000035320.1.26751 WP_000035320.1.26771 WP_000035320.1.26772 WP_000035320.1.26773 WP_000035320.1.26778 WP_000035320.1.26790 WP_000035320.1.2680 WP_000035320.1.26804 WP_000035320.1.2684 WP_000035320.1.26840 WP_000035320.1.26864 WP_000035320.1.26865 WP_000035320.1.26884 WP_000035320.1.2689 WP_000035320.1.26903 WP_000035320.1.26905 WP_000035320.1.26927 WP_000035320.1.26938 WP_000035320.1.26944 WP_000035320.1.26947 WP_000035320.1.26958 WP_000035320.1.27013 WP_000035320.1.27042 WP_000035320.1.27053 WP_000035320.1.27083 WP_000035320.1.2710 WP_000035320.1.27147 WP_000035320.1.27154 WP_000035320.1.27160 WP_000035320.1.27166 WP_000035320.1.27170 WP_000035320.1.2718 WP_000035320.1.27182 WP_000035320.1.27199 WP_000035320.1.27207 WP_000035320.1.27226 WP_000035320.1.27237 WP_000035320.1.27246 WP_000035320.1.2725 WP_000035320.1.27293 WP_000035320.1.27294 WP_000035320.1.27303 WP_000035320.1.27311 WP_000035320.1.27323 WP_000035320.1.27333 WP_000035320.1.2734 WP_000035320.1.27345 WP_000035320.1.27379 WP_000035320.1.27384 WP_000035320.1.27387 WP_000035320.1.27413 WP_000035320.1.2744 WP_000035320.1.27447 WP_000035320.1.27448 WP_000035320.1.27455 WP_000035320.1.27457 WP_000035320.1.27468 WP_000035320.1.27489 WP_000035320.1.27529 WP_000035320.1.2753 WP_000035320.1.27539 WP_000035320.1.27551 WP_000035320.1.27562 WP_000035320.1.2759 WP_000035320.1.27590 WP_000035320.1.27605 WP_000035320.1.27608 WP_000035320.1.27614 WP_000035320.1.27615 WP_000035320.1.27621 WP_000035320.1.27640 WP_000035320.1.27646 WP_000035320.1.27654 WP_000035320.1.2768 WP_000035320.1.27689 WP_000035320.1.27717 WP_000035320.1.27720 WP_000035320.1.27739 WP_000035320.1.27744 WP_000035320.1.27748 WP_000035320.1.27765 WP_000035320.1.27787 WP_000035320.1.27793 WP_000035320.1.27817 WP_000035320.1.27830 WP_000035320.1.27834 WP_000035320.1.27854 WP_000035320.1.2795 WP_000035320.1.27950 WP_000035320.1.27953 WP_000035320.1.27972 WP_000035320.1.28007 WP_000035320.1.28016 WP_000035320.1.28025 WP_000035320.1.28063 WP_000035320.1.28071 WP_000035320.1.28074 WP_000035320.1.2808 WP_000035320.1.28081 WP_000035320.1.28088 WP_000035320.1.28091 WP_000035320.1.28107 WP_000035320.1.28117 WP_000035320.1.28138 WP_000035320.1.28147 WP_000035320.1.28158 WP_000035320.1.28173 WP_000035320.1.28191 WP_000035320.1.28207 WP_000035320.1.28213 WP_000035320.1.28226 WP_000035320.1.28230 WP_000035320.1.28253 WP_000035320.1.28257 WP_000035320.1.28274 WP_000035320.1.28315 WP_000035320.1.28334 WP_000035320.1.28336 WP_000035320.1.28337 WP_000035320.1.28358 WP_000035320.1.28360 WP_000035320.1.28376 WP_000035320.1.28381 WP_000035320.1.28392 WP_000035320.1.28394 WP_000035320.1.2840 WP_000035320.1.28400 WP_000035320.1.28430 WP_000035320.1.28477 WP_000035320.1.28490 WP_000035320.1.28498 WP_000035320.1.28501 WP_000035320.1.28502 WP_000035320.1.2852 WP_000035320.1.28527 WP_000035320.1.28532 WP_000035320.1.28578 WP_000035320.1.28580 WP_000035320.1.28605 WP_000035320.1.28629 WP_000035320.1.28636 WP_000035320.1.28650 WP_000035320.1.28652 WP_000035320.1.28672 WP_000035320.1.28675 WP_000035320.1.28690 WP_000035320.1.28710 WP_000035320.1.28720 WP_000035320.1.28725 WP_000035320.1.28763 WP_000035320.1.28785 WP_000035320.1.28825 WP_000035320.1.28833 WP_000035320.1.28848 WP_000035320.1.28862 WP_000035320.1.28866 WP_000035320.1.28871 WP_000035320.1.28887 WP_000035320.1.28909 WP_000035320.1.28915 WP_000035320.1.28925 WP_000035320.1.28933 WP_000035320.1.28960 WP_000035320.1.28970 WP_000035320.1.28987 WP_000035320.1.29014 WP_000035320.1.29052 WP_000035320.1.2906 WP_000035320.1.29060 WP_000035320.1.29090 WP_000035320.1.29091 WP_000035320.1.29107 WP_000035320.1.29110 WP_000035320.1.29112 WP_000035320.1.29166 WP_000035320.1.29188 WP_000035320.1.29207 WP_000035320.1.29226 WP_000035320.1.29243 WP_000035320.1.29263 WP_000035320.1.29272 WP_000035320.1.29276 WP_000035320.1.29282 WP_000035320.1.29285 WP_000035320.1.29312 WP_000035320.1.29315 WP_000035320.1.29329 WP_000035320.1.29340 WP_000035320.1.29366 WP_000035320.1.29368 WP_000035320.1.29372 WP_000035320.1.29373 WP_000035320.1.29375 WP_000035320.1.29381 WP_000035320.1.29395 WP_000035320.1.29420 WP_000035320.1.29433 WP_000035320.1.29445 WP_000035320.1.29453 WP_000035320.1.29468 WP_000035320.1.29479 WP_000035320.1.29483 WP_000035320.1.29484 WP_000035320.1.29511 WP_000035320.1.29522 WP_000035320.1.29541 WP_000035320.1.29553 WP_000035320.1.29554 WP_000035320.1.29557 WP_000035320.1.29561 WP_000035320.1.2957 WP_000035320.1.29571 WP_000035320.1.29596 WP_000035320.1.29644 WP_000035320.1.29676 WP_000035320.1.29692 WP_000035320.1.29709 WP_000035320.1.29710 WP_000035320.1.29716 WP_000035320.1.2972 WP_000035320.1.29736 WP_000035320.1.29744 WP_000035320.1.2975 WP_000035320.1.29758 WP_000035320.1.29781 WP_000035320.1.29788 WP_000035320.1.29805 WP_000035320.1.2981 WP_000035320.1.29826 WP_000035320.1.29862 WP_000035320.1.29885 WP_000035320.1.29902 WP_000035320.1.29918 WP_000035320.1.29956 WP_000035320.1.29963 WP_000035320.1.30012 WP_000035320.1.30023 WP_000035320.1.30033 WP_000035320.1.30047 WP_000035320.1.30051 WP_000035320.1.30057 WP_000035320.1.30089 WP_000035320.1.30100 WP_000035320.1.30115 WP_000035320.1.3012 WP_000035320.1.30152 WP_000035320.1.30154 WP_000035320.1.30159 WP_000035320.1.30169 WP_000035320.1.30176 WP_000035320.1.30186 WP_000035320.1.30197 WP_000035320.1.30203 WP_000035320.1.30204 WP_000035320.1.30209 WP_000035320.1.30230 WP_000035320.1.30249 WP_000035320.1.30268 WP_000035320.1.30274 WP_000035320.1.3029 WP_000035320.1.30302 WP_000035320.1.30328 WP_000035320.1.30333 WP_000035320.1.30350 WP_000035320.1.30367 WP_000035320.1.30376 WP_000035320.1.30381 WP_000035320.1.30392 WP_000035320.1.30418 WP_000035320.1.30422 WP_000035320.1.30458 WP_000035320.1.30477 WP_000035320.1.30482 WP_000035320.1.30496 WP_000035320.1.3050 WP_000035320.1.30530 WP_000035320.1.30531 WP_000035320.1.30560 WP_000035320.1.30600 WP_000035320.1.30622 WP_000035320.1.30623 WP_000035320.1.30645 WP_000035320.1.30646 WP_000035320.1.30666 WP_000035320.1.30668 WP_000035320.1.30720 WP_000035320.1.30726 WP_000035320.1.30758 WP_000035320.1.30763 WP_000035320.1.3077 WP_000035320.1.30779 WP_000035320.1.30845 WP_000035320.1.30847 WP_000035320.1.30854 WP_000035320.1.30862 WP_000035320.1.30863 WP_000035320.1.30874 WP_000035320.1.30878 WP_000035320.1.30889 WP_000035320.1.30911 WP_000035320.1.30916 WP_000035320.1.30962 WP_000035320.1.3097 WP_000035320.1.30970 WP_000035320.1.30971 WP_000035320.1.30998 WP_000035320.1.31005 WP_000035320.1.31022 WP_000035320.1.31037 WP_000035320.1.31039 WP_000035320.1.31048 WP_000035320.1.31068 WP_000035320.1.31091 WP_000035320.1.31120 WP_000035320.1.31123 WP_000035320.1.31124 WP_000035320.1.31176 WP_000035320.1.31194 WP_000035320.1.31202 WP_000035320.1.31204 WP_000035320.1.31206 WP_000035320.1.31212 WP_000035320.1.31232 WP_000035320.1.31294 WP_000035320.1.31315 WP_000035320.1.3132 WP_000035320.1.31355 WP_000035320.1.31376 WP_000035320.1.31402 WP_000035320.1.31424 WP_000035320.1.31426 WP_000035320.1.31436 WP_000035320.1.31442 WP_000035320.1.31462 WP_000035320.1.31468 WP_000035320.1.31478 WP_000035320.1.31479 WP_000035320.1.31484 WP_000035320.1.315 WP_000035320.1.31505 WP_000035320.1.31529 WP_000035320.1.31531 WP_000035320.1.31539 WP_000035320.1.31567 WP_000035320.1.31611 WP_000035320.1.31621 WP_000035320.1.31638 WP_000035320.1.31642 WP_000035320.1.31667 WP_000035320.1.31686 WP_000035320.1.31701 WP_000035320.1.31753 WP_000035320.1.31787 WP_000035320.1.31791 WP_000035320.1.31797 WP_000035320.1.31806 WP_000035320.1.31817 WP_000035320.1.31827 WP_000035320.1.31892 WP_000035320.1.31897 WP_000035320.1.31925 WP_000035320.1.31931 WP_000035320.1.31949 WP_000035320.1.31990 WP_000035320.1.31994 WP_000035320.1.31997 WP_000035320.1.32003 WP_000035320.1.32005 WP_000035320.1.32029 WP_000035320.1.32040 WP_000035320.1.32059 WP_000035320.1.32118 WP_000035320.1.32122 WP_000035320.1.32125 WP_000035320.1.32130 WP_000035320.1.32160 WP_000035320.1.32167 WP_000035320.1.3219 WP_000035320.1.32207 WP_000035320.1.32217 WP_000035320.1.32244 WP_000035320.1.32248 WP_000035320.1.32270 WP_000035320.1.32281 WP_000035320.1.3229 WP_000035320.1.32295 WP_000035320.1.32325 WP_000035320.1.32338 WP_000035320.1.32340 WP_000035320.1.32348 WP_000035320.1.32365 WP_000035320.1.32384 WP_000035320.1.32405 WP_000035320.1.3242 WP_000035320.1.3244 WP_000035320.1.32454 WP_000035320.1.32464 WP_000035320.1.32474 WP_000035320.1.32481 WP_000035320.1.32483 WP_000035320.1.32517 WP_000035320.1.32534 WP_000035320.1.32555 WP_000035320.1.32565 WP_000035320.1.32584 WP_000035320.1.32588 WP_000035320.1.32607 WP_000035320.1.32634 WP_000035320.1.32636 WP_000035320.1.32645 WP_000035320.1.32671 WP_000035320.1.32739 WP_000035320.1.32746 WP_000035320.1.32754 WP_000035320.1.32770 WP_000035320.1.32795 WP_000035320.1.328 WP_000035320.1.32800 WP_000035320.1.32839 WP_000035320.1.32921 WP_000035320.1.32925 WP_000035320.1.3293 WP_000035320.1.32939 WP_000035320.1.32954 WP_000035320.1.32965 WP_000035320.1.32980 WP_000035320.1.32987 WP_000035320.1.3299 WP_000035320.1.3301 WP_000035320.1.33038 WP_000035320.1.33048 WP_000035320.1.3306 WP_000035320.1.33108 WP_000035320.1.33123 WP_000035320.1.33138 WP_000035320.1.33147 WP_000035320.1.3316 WP_000035320.1.33161 WP_000035320.1.33172 WP_000035320.1.33199 WP_000035320.1.33212 WP_000035320.1.33213 WP_000035320.1.33250 WP_000035320.1.33252 WP_000035320.1.33255 WP_000035320.1.33266 WP_000035320.1.33292 WP_000035320.1.33307 WP_000035320.1.33335 WP_000035320.1.3335 WP_000035320.1.33350 WP_000035320.1.33357 WP_000035320.1.33368 WP_000035320.1.33372 WP_000035320.1.3338 WP_000035320.1.33388 WP_000035320.1.33394 WP_000035320.1.3341 WP_000035320.1.33416 WP_000035320.1.3342 WP_000035320.1.33426 WP_000035320.1.33432 WP_000035320.1.3345 WP_000035320.1.33463 WP_000035320.1.33468 WP_000035320.1.33483 WP_000035320.1.33484 WP_000035320.1.33516 WP_000035320.1.33518 WP_000035320.1.33520 WP_000035320.1.33540 WP_000035320.1.3357 WP_000035320.1.33575 WP_000035320.1.33594 WP_000035320.1.33610 WP_000035320.1.33626 WP_000035320.1.33627 WP_000035320.1.3363 WP_000035320.1.33640 WP_000035320.1.33650 WP_000035320.1.33692 WP_000035320.1.33718 WP_000035320.1.33720 WP_000035320.1.33724 WP_000035320.1.33735 WP_000035320.1.33737 WP_000035320.1.33756 WP_000035320.1.33765 WP_000035320.1.33766 WP_000035320.1.33769 WP_000035320.1.33778 WP_000035320.1.33804 WP_000035320.1.33816 WP_000035320.1.33855 WP_000035320.1.33899 WP_000035320.1.33915 WP_000035320.1.33940 WP_000035320.1.33949 WP_000035320.1.33963 WP_000035320.1.33966 WP_000035320.1.33968 WP_000035320.1.33983 WP_000035320.1.34026 WP_000035320.1.34030 WP_000035320.1.34051 WP_000035320.1.34062 WP_000035320.1.34069 WP_000035320.1.34079 WP_000035320.1.34080 WP_000035320.1.34089 WP_000035320.1.34100 WP_000035320.1.34105 WP_000035320.1.34112 WP_000035320.1.34128 WP_000035320.1.34132 WP_000035320.1.3418 WP_000035320.1.34182 WP_000035320.1.34194 WP_000035320.1.3422 WP_000035320.1.34223 WP_000035320.1.34231 WP_000035320.1.34250 WP_000035320.1.34280 WP_000035320.1.34285 WP_000035320.1.34334 WP_000035320.1.34361 WP_000035320.1.34381 WP_000035320.1.3442 WP_000035320.1.34436 WP_000035320.1.34471 WP_000035320.1.3448 WP_000035320.1.34482 WP_000035320.1.34510 WP_000035320.1.34512 WP_000035320.1.34526 WP_000035320.1.34569 WP_000035320.1.34620 WP_000035320.1.34626 WP_000035320.1.34666 WP_000035320.1.34677 WP_000035320.1.34716 WP_000035320.1.34723 WP_000035320.1.3474 WP_000035320.1.34741 WP_000035320.1.34767 WP_000035320.1.34847 WP_000035320.1.34865 WP_000035320.1.34890 WP_000035320.1.34918 WP_000035320.1.34923 WP_000035320.1.34926 WP_000035320.1.34967 WP_000035320.1.34970 WP_000035320.1.34998 WP_000035320.1.35014 WP_000035320.1.35031 WP_000035320.1.35032 WP_000035320.1.35059 WP_000035320.1.35062 WP_000035320.1.35097 WP_000035320.1.35106 WP_000035320.1.35108 WP_000035320.1.35121 WP_000035320.1.35177 WP_000035320.1.35189 WP_000035320.1.35222 WP_000035320.1.35233 WP_000035320.1.35257 WP_000035320.1.35276 WP_000035320.1.35285 WP_000035320.1.35289 WP_000035320.1.35297 WP_000035320.1.35307 WP_000035320.1.35314 WP_000035320.1.35334 WP_000035320.1.35340 WP_000035320.1.35352 WP_000035320.1.35391 WP_000035320.1.354 WP_000035320.1.35413 WP_000035320.1.35490 WP_000035320.1.35497 WP_000035320.1.35508 WP_000035320.1.35517 WP_000035320.1.35519 WP_000035320.1.3552 WP_000035320.1.35549 WP_000035320.1.35580 WP_000035320.1.35615 WP_000035320.1.35642 WP_000035320.1.35643 WP_000035320.1.35659 WP_000035320.1.35661 WP_000035320.1.35673 WP_000035320.1.35686 WP_000035320.1.3569 WP_000035320.1.35696 WP_000035320.1.35746 WP_000035320.1.35774 WP_000035320.1.35784 WP_000035320.1.3579 WP_000035320.1.35794 WP_000035320.1.35799 WP_000035320.1.35801 WP_000035320.1.35826 WP_000035320.1.35888 WP_000035320.1.35890 WP_000035320.1.35900 WP_000035320.1.35903 WP_000035320.1.35928 WP_000035320.1.36021 WP_000035320.1.36093 WP_000035320.1.36117 WP_000035320.1.36141 WP_000035320.1.3617 WP_000035320.1.36175 WP_000035320.1.36176 WP_000035320.1.36179 WP_000035320.1.36187 WP_000035320.1.36188 WP_000035320.1.36193 WP_000035320.1.36208 WP_000035320.1.36211 WP_000035320.1.36220 WP_000035320.1.3623 WP_000035320.1.36249 WP_000035320.1.36250 WP_000035320.1.36264 WP_000035320.1.36278 WP_000035320.1.36282 WP_000035320.1.36283 WP_000035320.1.36302 WP_000035320.1.36307 WP_000035320.1.36325 WP_000035320.1.36344 WP_000035320.1.36389 WP_000035320.1.36430 WP_000035320.1.36434 WP_000035320.1.36439 WP_000035320.1.36522 WP_000035320.1.36532 WP_000035320.1.36535 WP_000035320.1.3655 WP_000035320.1.36551 WP_000035320.1.36570 WP_000035320.1.36580 WP_000035320.1.36600 WP_000035320.1.36604 WP_000035320.1.36615 WP_000035320.1.36640 WP_000035320.1.3666 WP_000035320.1.36669 WP_000035320.1.36689 WP_000035320.1.36697 WP_000035320.1.36704 WP_000035320.1.36729 WP_000035320.1.36745 WP_000035320.1.3675 WP_000035320.1.36770 WP_000035320.1.36773 WP_000035320.1.36783 WP_000035320.1.36793 WP_000035320.1.36796 WP_000035320.1.36809 WP_000035320.1.36814 WP_000035320.1.36822 WP_000035320.1.36823 WP_000035320.1.36847 WP_000035320.1.36858 WP_000035320.1.3687 WP_000035320.1.36884 WP_000035320.1.36888 WP_000035320.1.36903 WP_000035320.1.36911 WP_000035320.1.36952 WP_000035320.1.36955 WP_000035320.1.36979 WP_000035320.1.36980 WP_000035320.1.36983 WP_000035320.1.36997 WP_000035320.1.37016 WP_000035320.1.3703 WP_000035320.1.37044 WP_000035320.1.37053 WP_000035320.1.37055 WP_000035320.1.37075 WP_000035320.1.3709 WP_000035320.1.37120 WP_000035320.1.37121 WP_000035320.1.37130 WP_000035320.1.37132 WP_000035320.1.37135 WP_000035320.1.37145 WP_000035320.1.37159 WP_000035320.1.3722 WP_000035320.1.37220 WP_000035320.1.37240 WP_000035320.1.37304 WP_000035320.1.37335 WP_000035320.1.37341 WP_000035320.1.37354 WP_000035320.1.37378 WP_000035320.1.37398 WP_000035320.1.37408 WP_000035320.1.37411 WP_000035320.1.37424 WP_000035320.1.37435 WP_000035320.1.37503 WP_000035320.1.37536 WP_000035320.1.37546 WP_000035320.1.37563 WP_000035320.1.37583 WP_000035320.1.37602 WP_000035320.1.37605 WP_000035320.1.37606 WP_000035320.1.37621 WP_000035320.1.37624 WP_000035320.1.37636 WP_000035320.1.37644 WP_000035320.1.37652 WP_000035320.1.37669 WP_000035320.1.37679 WP_000035320.1.3774 WP_000035320.1.37749 WP_000035320.1.3776 WP_000035320.1.37764 WP_000035320.1.37771 WP_000035320.1.37781 WP_000035320.1.37788 WP_000035320.1.37795 WP_000035320.1.37815 WP_000035320.1.37828 WP_000035320.1.37851 WP_000035320.1.37906 WP_000035320.1.37907 WP_000035320.1.37929 WP_000035320.1.37953 WP_000035320.1.37987 WP_000035320.1.38007 WP_000035320.1.38030 WP_000035320.1.38038 WP_000035320.1.38057 WP_000035320.1.38070 WP_000035320.1.3809 WP_000035320.1.38100 WP_000035320.1.38111 WP_000035320.1.38128 WP_000035320.1.38136 WP_000035320.1.38160 WP_000035320.1.38177 WP_000035320.1.38212 WP_000035320.1.38222 WP_000035320.1.3827 WP_000035320.1.38276 WP_000035320.1.38282 WP_000035320.1.38304 WP_000035320.1.38309 WP_000035320.1.38311 WP_000035320.1.38316 WP_000035320.1.38330 WP_000035320.1.38336 WP_000035320.1.38339 WP_000035320.1.38346 WP_000035320.1.38383 WP_000035320.1.38390 WP_000035320.1.3842 WP_000035320.1.38422 WP_000035320.1.38435 WP_000035320.1.38437 WP_000035320.1.38489 WP_000035320.1.38493 WP_000035320.1.38516 WP_000035320.1.3852 WP_000035320.1.38522 WP_000035320.1.38546 WP_000035320.1.38551 WP_000035320.1.38555 WP_000035320.1.38600 WP_000035320.1.38607 WP_000035320.1.38612 WP_000035320.1.38637 WP_000035320.1.38658 WP_000035320.1.3867 WP_000035320.1.38674 WP_000035320.1.38688 WP_000035320.1.3875 WP_000035320.1.38760 WP_000035320.1.38823 WP_000035320.1.38841 WP_000035320.1.38858 WP_000035320.1.38862 WP_000035320.1.38875 WP_000035320.1.38885 WP_000035320.1.38890 WP_000035320.1.38926 WP_000035320.1.38927 WP_000035320.1.38931 WP_000035320.1.3894 WP_000035320.1.38940 WP_000035320.1.38941 WP_000035320.1.38960 WP_000035320.1.38972 WP_000035320.1.38989 WP_000035320.1.390 WP_000035320.1.39014 WP_000035320.1.39017 WP_000035320.1.39026 WP_000035320.1.3906 WP_000035320.1.391 WP_000035320.1.39108 WP_000035320.1.39117 WP_000035320.1.39126 WP_000035320.1.39166 WP_000035320.1.39173 WP_000035320.1.39206 WP_000035320.1.39217 WP_000035320.1.3926 WP_000035320.1.39272 WP_000035320.1.39281 WP_000035320.1.39290 WP_000035320.1.39324 WP_000035320.1.39330 WP_000035320.1.39332 WP_000035320.1.39361 WP_000035320.1.39384 WP_000035320.1.39397 WP_000035320.1.39406 WP_000035320.1.39432 WP_000035320.1.39486 WP_000035320.1.39494 WP_000035320.1.39499 WP_000035320.1.39506 WP_000035320.1.39527 WP_000035320.1.39542 WP_000035320.1.39625 WP_000035320.1.39642 WP_000035320.1.39645 WP_000035320.1.39662 WP_000035320.1.39670 WP_000035320.1.39671 WP_000035320.1.39682 WP_000035320.1.39689 WP_000035320.1.39693 WP_000035320.1.39697 WP_000035320.1.39711 WP_000035320.1.39738 WP_000035320.1.39767 WP_000035320.1.39773 WP_000035320.1.39812 WP_000035320.1.39832 WP_000035320.1.39834 WP_000035320.1.39838 WP_000035320.1.39839 WP_000035320.1.39857 WP_000035320.1.39869 WP_000035320.1.39875 WP_000035320.1.39880 WP_000035320.1.39918 WP_000035320.1.39943 WP_000035320.1.39995 WP_000035320.1.40014 WP_000035320.1.40043 WP_000035320.1.40053 WP_000035320.1.4006 WP_000035320.1.40076 WP_000035320.1.40082 WP_000035320.1.40085 WP_000035320.1.40099 WP_000035320.1.4010 WP_000035320.1.4012 WP_000035320.1.40130 WP_000035320.1.40137 WP_000035320.1.40149 WP_000035320.1.4015 WP_000035320.1.40164 WP_000035320.1.40173 WP_000035320.1.4019 WP_000035320.1.40220 WP_000035320.1.40247 WP_000035320.1.4025 WP_000035320.1.40299 WP_000035320.1.40316 WP_000035320.1.40318 WP_000035320.1.40320 WP_000035320.1.40322 WP_000035320.1.40329 WP_000035320.1.40330 WP_000035320.1.40340 WP_000035320.1.40342 WP_000035320.1.40368 WP_000035320.1.40369 WP_000035320.1.40406 WP_000035320.1.40409 WP_000035320.1.40428 WP_000035320.1.40435 WP_000035320.1.4045 WP_000035320.1.40472 WP_000035320.1.40481 WP_000035320.1.40483 WP_000035320.1.40500 WP_000035320.1.40505 WP_000035320.1.40531 WP_000035320.1.4057 WP_000035320.1.40579 WP_000035320.1.40588 WP_000035320.1.40613 WP_000035320.1.40620 WP_000035320.1.40644 WP_000035320.1.40655 WP_000035320.1.40659 WP_000035320.1.40670 WP_000035320.1.40700 WP_000035320.1.40719 WP_000035320.1.40729 WP_000035320.1.40760 WP_000035320.1.4078 WP_000035320.1.40780 WP_000035320.1.40794 WP_000035320.1.40797 WP_000035320.1.40814 WP_000035320.1.40939 WP_000035320.1.40954 WP_000035320.1.40997 WP_000035320.1.41033 WP_000035320.1.41038 WP_000035320.1.4105 WP_000035320.1.41064 WP_000035320.1.41066 WP_000035320.1.41084 WP_000035320.1.41094 WP_000035320.1.41109 WP_000035320.1.41119 WP_000035320.1.41129 WP_000035320.1.41178 WP_000035320.1.412 WP_000035320.1.41208 WP_000035320.1.41238 WP_000035320.1.41241 WP_000035320.1.41245 WP_000035320.1.41255 WP_000035320.1.41288 WP_000035320.1.41289 WP_000035320.1.4129 WP_000035320.1.41314 WP_000035320.1.41374 WP_000035320.1.4138 WP_000035320.1.41386 WP_000035320.1.41389 WP_000035320.1.41411 WP_000035320.1.41426 WP_000035320.1.41432 WP_000035320.1.41433 WP_000035320.1.41448 WP_000035320.1.41458 WP_000035320.1.41461 WP_000035320.1.41499 WP_000035320.1.41511 WP_000035320.1.41555 WP_000035320.1.41567 WP_000035320.1.41581 WP_000035320.1.41587 WP_000035320.1.41598 WP_000035320.1.41599 WP_000035320.1.4160 WP_000035320.1.4162 WP_000035320.1.41620 WP_000035320.1.41623 WP_000035320.1.41647 WP_000035320.1.41674 WP_000035320.1.41681 WP_000035320.1.4169 WP_000035320.1.41726 WP_000035320.1.41743 WP_000035320.1.41755 WP_000035320.1.41770 WP_000035320.1.4182 WP_000035320.1.41839 WP_000035320.1.41863 WP_000035320.1.4188 WP_000035320.1.41898 WP_000035320.1.41906 WP_000035320.1.41943 WP_000035320.1.41972 WP_000035320.1.41983 WP_000035320.1.41989 WP_000035320.1.420 WP_000035320.1.42003 WP_000035320.1.42005 WP_000035320.1.4202 WP_000035320.1.42028 WP_000035320.1.42056 WP_000035320.1.42064 WP_000035320.1.42072 WP_000035320.1.42085 WP_000035320.1.42087 WP_000035320.1.42137 WP_000035320.1.42169 WP_000035320.1.42177 WP_000035320.1.42178 WP_000035320.1.42198 WP_000035320.1.42230 WP_000035320.1.42241 WP_000035320.1.4225 WP_000035320.1.42269 WP_000035320.1.42286 WP_000035320.1.42298 WP_000035320.1.42305 WP_000035320.1.4231 WP_000035320.1.42325 WP_000035320.1.42336 WP_000035320.1.42344 WP_000035320.1.42355 WP_000035320.1.42403 WP_000035320.1.42436 WP_000035320.1.42438 WP_000035320.1.42455 WP_000035320.1.42459 WP_000035320.1.42503 WP_000035320.1.42510 WP_000035320.1.42517 WP_000035320.1.42575 WP_000035320.1.42593 WP_000035320.1.42598 WP_000035320.1.426 WP_000035320.1.4260 WP_000035320.1.42607 WP_000035320.1.42640 WP_000035320.1.42652 WP_000035320.1.42667 WP_000035320.1.42668 WP_000035320.1.42674 WP_000035320.1.42679 WP_000035320.1.42706 WP_000035320.1.42733 WP_000035320.1.42759 WP_000035320.1.42764 WP_000035320.1.42786 WP_000035320.1.42788 WP_000035320.1.42798 WP_000035320.1.42802 WP_000035320.1.42816 WP_000035320.1.42837 WP_000035320.1.42883 WP_000035320.1.42893 WP_000035320.1.42907 WP_000035320.1.42925 WP_000035320.1.4293 WP_000035320.1.42959 WP_000035320.1.42982 WP_000035320.1.42984 WP_000035320.1.42985 WP_000035320.1.4299 WP_000035320.1.42990 WP_000035320.1.43014 WP_000035320.1.43023 WP_000035320.1.43033 WP_000035320.1.43047 WP_000035320.1.43061 WP_000035320.1.43095 WP_000035320.1.43110 WP_000035320.1.43122 WP_000035320.1.43125 WP_000035320.1.43134 WP_000035320.1.43139 WP_000035320.1.43143 WP_000035320.1.43147 WP_000035320.1.43159 WP_000035320.1.43165 WP_000035320.1.43168 WP_000035320.1.43179 WP_000035320.1.43202 WP_000035320.1.43204 WP_000035320.1.43232 WP_000035320.1.4325 WP_000035320.1.43252 WP_000035320.1.43263 WP_000035320.1.4327 WP_000035320.1.43274 WP_000035320.1.43279 WP_000035320.1.43323 WP_000035320.1.43328 WP_000035320.1.43331 WP_000035320.1.43341 WP_000035320.1.43360 WP_000035320.1.43366 WP_000035320.1.43369 WP_000035320.1.43375 WP_000035320.1.43405 WP_000035320.1.43406 WP_000035320.1.4341 WP_000035320.1.43410 WP_000035320.1.43414 WP_000035320.1.43446 WP_000035320.1.43460 WP_000035320.1.4347 WP_000035320.1.43512 WP_000035320.1.43530 WP_000035320.1.43550 WP_000035320.1.43560 WP_000035320.1.43573 WP_000035320.1.43600 WP_000035320.1.43617 WP_000035320.1.43618 WP_000035320.1.43627 WP_000035320.1.43659 WP_000035320.1.43665 WP_000035320.1.43670 WP_000035320.1.43683 WP_000035320.1.43693 WP_000035320.1.4370 WP_000035320.1.43702 WP_000035320.1.43703 WP_000035320.1.4372 WP_000035320.1.43731 WP_000035320.1.4374 WP_000035320.1.43784 WP_000035320.1.43800 WP_000035320.1.43819 WP_000035320.1.43822 WP_000035320.1.43827 WP_000035320.1.43851 WP_000035320.1.4386 WP_000035320.1.43904 WP_000035320.1.43915 WP_000035320.1.43924 WP_000035320.1.43964 WP_000035320.1.43984 WP_000035320.1.44072 WP_000035320.1.44074 WP_000035320.1.44095 WP_000035320.1.44119 WP_000035320.1.44177 WP_000035320.1.44178 WP_000035320.1.44265 WP_000035320.1.44302 WP_000035320.1.44312 WP_000035320.1.44344 WP_000035320.1.44382 WP_000035320.1.44405 WP_000035320.1.44420 WP_000035320.1.44432 WP_000035320.1.44455 WP_000035320.1.44493 WP_000035320.1.44504 WP_000035320.1.44515 WP_000035320.1.44520 WP_000035320.1.44544 WP_000035320.1.44586 WP_000035320.1.44588 WP_000035320.1.44605 WP_000035320.1.44623 WP_000035320.1.44631 WP_000035320.1.44655 WP_000035320.1.44667 WP_000035320.1.44672 WP_000035320.1.44674 WP_000035320.1.447 WP_000035320.1.44714 WP_000035320.1.44715 WP_000035320.1.44732 WP_000035320.1.44755 WP_000035320.1.44768 WP_000035320.1.44780 WP_000035320.1.44785 WP_000035320.1.44788 WP_000035320.1.44802 WP_000035320.1.44853 WP_000035320.1.44856 WP_000035320.1.44868 WP_000035320.1.44876 WP_000035320.1.44882 WP_000035320.1.44891 WP_000035320.1.44892 WP_000035320.1.44899 WP_000035320.1.44903 WP_000035320.1.44914 WP_000035320.1.44932 WP_000035320.1.44940 WP_000035320.1.44955 WP_000035320.1.44969 WP_000035320.1.44993 WP_000035320.1.45015 WP_000035320.1.45033 WP_000035320.1.45035 WP_000035320.1.45042 WP_000035320.1.45050 WP_000035320.1.45080 WP_000035320.1.45091 WP_000035320.1.45094 WP_000035320.1.45099 WP_000035320.1.45111 WP_000035320.1.4513 WP_000035320.1.45131 WP_000035320.1.45132 WP_000035320.1.45133 WP_000035320.1.45140 WP_000035320.1.45157 WP_000035320.1.45162 WP_000035320.1.45164 WP_000035320.1.45188 WP_000035320.1.45189 WP_000035320.1.452 WP_000035320.1.45218 WP_000035320.1.45223 WP_000035320.1.45242 WP_000035320.1.45267 WP_000035320.1.4527 WP_000035320.1.45272 WP_000035320.1.45281 WP_000035320.1.45290 WP_000035320.1.45297 WP_000035320.1.453 WP_000035320.1.45321 WP_000035320.1.45332 WP_000035320.1.45364 WP_000035320.1.45419 WP_000035320.1.45431 WP_000035320.1.45439 WP_000035320.1.4545 WP_000035320.1.45450 WP_000035320.1.45456 WP_000035320.1.4546 WP_000035320.1.45472 WP_000035320.1.45492 WP_000035320.1.4550 WP_000035320.1.45507 WP_000035320.1.45542 WP_000035320.1.45555 WP_000035320.1.45560 WP_000035320.1.45574 WP_000035320.1.45610 WP_000035320.1.45620 WP_000035320.1.45640 WP_000035320.1.45645 WP_000035320.1.45654 WP_000035320.1.45670 WP_000035320.1.45698 WP_000035320.1.45703 WP_000035320.1.45705 WP_000035320.1.45713 WP_000035320.1.45730 WP_000035320.1.45734 WP_000035320.1.45747 WP_000035320.1.45763 WP_000035320.1.4577 WP_000035320.1.45771 WP_000035320.1.45773 WP_000035320.1.45780 WP_000035320.1.4580 WP_000035320.1.4582 WP_000035320.1.45833 WP_000035320.1.4584 WP_000035320.1.45852 WP_000035320.1.45859 WP_000035320.1.45862 WP_000035320.1.45870 WP_000035320.1.45874 WP_000035320.1.45875 WP_000035320.1.45881 WP_000035320.1.45888 WP_000035320.1.459 WP_000035320.1.45954 WP_000035320.1.4597 WP_000035320.1.45972 WP_000035320.1.45977 WP_000035320.1.45979 WP_000035320.1.4598 WP_000035320.1.46021 WP_000035320.1.46035 WP_000035320.1.46037 WP_000035320.1.46050 WP_000035320.1.46055 WP_000035320.1.46062 WP_000035320.1.46071 WP_000035320.1.46078 WP_000035320.1.46082 WP_000035320.1.46087 WP_000035320.1.46106 WP_000035320.1.46136 WP_000035320.1.46168 WP_000035320.1.46171 WP_000035320.1.46172 WP_000035320.1.46185 WP_000035320.1.46195 WP_000035320.1.46208 WP_000035320.1.46212 WP_000035320.1.46248 WP_000035320.1.46259 WP_000035320.1.46289 WP_000035320.1.46320 WP_000035320.1.46330 WP_000035320.1.46333 WP_000035320.1.46334 WP_000035320.1.46339 WP_000035320.1.46353 WP_000035320.1.46362 WP_000035320.1.46389 WP_000035320.1.46401 WP_000035320.1.46418 WP_000035320.1.46422 WP_000035320.1.46457 WP_000035320.1.46514 WP_000035320.1.46528 WP_000035320.1.46529 WP_000035320.1.46534 WP_000035320.1.46608 WP_000035320.1.46619 WP_000035320.1.46648 WP_000035320.1.46660 WP_000035320.1.46664 WP_000035320.1.46670 WP_000035320.1.46688 WP_000035320.1.46692 WP_000035320.1.46702 WP_000035320.1.46703 WP_000035320.1.46720 WP_000035320.1.46736 WP_000035320.1.46752 WP_000035320.1.46765 WP_000035320.1.46767 WP_000035320.1.46770 WP_000035320.1.46772 WP_000035320.1.4680 WP_000035320.1.46815 WP_000035320.1.46823 WP_000035320.1.46837 WP_000035320.1.46852 WP_000035320.1.46875 WP_000035320.1.46881 WP_000035320.1.46906 WP_000035320.1.46908 WP_000035320.1.46911 WP_000035320.1.46914 WP_000035320.1.46929 WP_000035320.1.46937 WP_000035320.1.4694 WP_000035320.1.46947 WP_000035320.1.4696 WP_000035320.1.46964 WP_000035320.1.46983 WP_000035320.1.46995 WP_000035320.1.47002 WP_000035320.1.47090 WP_000035320.1.47105 WP_000035320.1.47107 WP_000035320.1.47111 WP_000035320.1.47153 WP_000035320.1.47159 WP_000035320.1.4716 WP_000035320.1.47163 WP_000035320.1.47175 WP_000035320.1.47187 WP_000035320.1.47193 WP_000035320.1.47205 WP_000035320.1.47216 WP_000035320.1.47218 WP_000035320.1.47258 WP_000035320.1.47269 WP_000035320.1.4728 WP_000035320.1.47282 WP_000035320.1.47290 WP_000035320.1.47294 WP_000035320.1.47306 WP_000035320.1.47317 WP_000035320.1.47331 WP_000035320.1.47334 WP_000035320.1.47353 WP_000035320.1.47381 WP_000035320.1.47383 WP_000035320.1.47399 WP_000035320.1.47405 WP_000035320.1.47406 WP_000035320.1.47422 WP_000035320.1.47426 WP_000035320.1.47432 WP_000035320.1.47439 WP_000035320.1.47459 WP_000035320.1.47493 WP_000035320.1.4752 WP_000035320.1.47522 WP_000035320.1.47541 WP_000035320.1.47560 WP_000035320.1.47561 WP_000035320.1.47570 WP_000035320.1.47577 WP_000035320.1.47617 WP_000035320.1.47618 WP_000035320.1.47629 WP_000035320.1.47669 WP_000035320.1.4767 WP_000035320.1.47680 WP_000035320.1.47702 WP_000035320.1.47733 WP_000035320.1.47747 WP_000035320.1.47763 WP_000035320.1.47792 WP_000035320.1.47821 WP_000035320.1.47835 WP_000035320.1.47836 WP_000035320.1.47851 WP_000035320.1.47859 WP_000035320.1.47864 WP_000035320.1.47872 WP_000035320.1.47873 WP_000035320.1.47901 WP_000035320.1.47904 WP_000035320.1.47908 WP_000035320.1.4792 WP_000035320.1.47951 WP_000035320.1.47980 WP_000035320.1.47996 WP_000035320.1.48009 WP_000035320.1.48011 WP_000035320.1.48030 WP_000035320.1.48046 WP_000035320.1.48047 WP_000035320.1.48057 WP_000035320.1.48064 WP_000035320.1.48067 WP_000035320.1.48116 WP_000035320.1.48142 WP_000035320.1.48149 WP_000035320.1.4815 WP_000035320.1.48154 WP_000035320.1.48156 WP_000035320.1.48169 WP_000035320.1.48186 WP_000035320.1.48187 WP_000035320.1.48199 WP_000035320.1.48205 WP_000035320.1.48212 WP_000035320.1.48223 WP_000035320.1.48227 WP_000035320.1.48236 WP_000035320.1.48272 WP_000035320.1.48282 WP_000035320.1.48284 WP_000035320.1.48293 WP_000035320.1.48307 WP_000035320.1.48310 WP_000035320.1.48322 WP_000035320.1.48326 WP_000035320.1.48335 WP_000035320.1.48338 WP_000035320.1.48364 WP_000035320.1.48376 WP_000035320.1.48391 WP_000035320.1.48394 WP_000035320.1.48398 WP_000035320.1.484 WP_000035320.1.4840 WP_000035320.1.48427 WP_000035320.1.48437 WP_000035320.1.48438 WP_000035320.1.48463 WP_000035320.1.48479 WP_000035320.1.48492 WP_000035320.1.4852 WP_000035320.1.48556 WP_000035320.1.48577 WP_000035320.1.48580 WP_000035320.1.48593 WP_000035320.1.48634 WP_000035320.1.48655 WP_000035320.1.48664 WP_000035320.1.48670 WP_000035320.1.4868 WP_000035320.1.48694 WP_000035320.1.48705 WP_000035320.1.48711 WP_000035320.1.48723 WP_000035320.1.48769 WP_000035320.1.48782 WP_000035320.1.48786 WP_000035320.1.48805 WP_000035320.1.48817 WP_000035320.1.48833 WP_000035320.1.4886 WP_000035320.1.48869 WP_000035320.1.48936 WP_000035320.1.48945 WP_000035320.1.48982 WP_000035320.1.48993 WP_000035320.1.4901 WP_000035320.1.49018 WP_000035320.1.49032 WP_000035320.1.49071 WP_000035320.1.49094 WP_000035320.1.49105 WP_000035320.1.49128 WP_000035320.1.49129 WP_000035320.1.49143 WP_000035320.1.49150 WP_000035320.1.49159 WP_000035320.1.4916 WP_000035320.1.49161 WP_000035320.1.49171 WP_000035320.1.4918 WP_000035320.1.49189 WP_000035320.1.49196 WP_000035320.1.49199 WP_000035320.1.49207 WP_000035320.1.4921 WP_000035320.1.4924 WP_000035320.1.49257 WP_000035320.1.49301 WP_000035320.1.49326 WP_000035320.1.49362 WP_000035320.1.49418 WP_000035320.1.49444 WP_000035320.1.49479 WP_000035320.1.49484 WP_000035320.1.4950 WP_000035320.1.49518 WP_000035320.1.49530 WP_000035320.1.49539 WP_000035320.1.49549 WP_000035320.1.49573 WP_000035320.1.49581 WP_000035320.1.49582 WP_000035320.1.496 WP_000035320.1.49603 WP_000035320.1.49643 WP_000035320.1.49653 WP_000035320.1.49658 WP_000035320.1.49671 WP_000035320.1.49672 WP_000035320.1.49690 WP_000035320.1.49707 WP_000035320.1.49728 WP_000035320.1.49730 WP_000035320.1.49732 WP_000035320.1.49742 WP_000035320.1.49745 WP_000035320.1.49757 WP_000035320.1.4980 WP_000035320.1.49800 WP_000035320.1.49819 WP_000035320.1.4984 WP_000035320.1.49860 WP_000035320.1.49863 WP_000035320.1.4987 WP_000035320.1.49871 WP_000035320.1.4989 WP_000035320.1.49894 WP_000035320.1.49907 WP_000035320.1.49917 WP_000035320.1.49918 WP_000035320.1.49921 WP_000035320.1.49934 WP_000035320.1.49935 WP_000035320.1.4994 WP_000035320.1.49943 WP_000035320.1.49951 WP_000035320.1.50013 WP_000035320.1.50023 WP_000035320.1.50028 WP_000035320.1.50038 WP_000035320.1.50039 WP_000035320.1.50064 WP_000035320.1.50076 WP_000035320.1.50117 WP_000035320.1.50138 WP_000035320.1.50145 WP_000035320.1.50175 WP_000035320.1.50178 WP_000035320.1.50192 WP_000035320.1.50212 WP_000035320.1.50217 WP_000035320.1.50261 WP_000035320.1.50291 WP_000035320.1.50313 WP_000035320.1.50314 WP_000035320.1.5035 WP_000035320.1.50356 WP_000035320.1.50367 WP_000035320.1.50377 WP_000035320.1.50388 WP_000035320.1.50424 WP_000035320.1.50425 WP_000035320.1.50430 WP_000035320.1.50440 WP_000035320.1.5045 WP_000035320.1.50464 WP_000035320.1.50477 WP_000035320.1.50525 WP_000035320.1.50527 WP_000035320.1.50543 WP_000035320.1.50555 WP_000035320.1.50556 WP_000035320.1.50558 WP_000035320.1.50568 WP_000035320.1.50578 WP_000035320.1.5059 WP_000035320.1.50594 WP_000035320.1.50595 WP_000035320.1.50647 WP_000035320.1.50660 WP_000035320.1.50699 WP_000035320.1.50732 WP_000035320.1.50740 WP_000035320.1.50742 WP_000035320.1.50748 WP_000035320.1.50768 WP_000035320.1.50799 WP_000035320.1.50817 WP_000035320.1.50820 WP_000035320.1.50829 WP_000035320.1.5087 WP_000035320.1.50937 WP_000035320.1.50958 WP_000035320.1.50962 WP_000035320.1.50974 WP_000035320.1.51015 WP_000035320.1.5108 WP_000035320.1.5109 WP_000035320.1.51130 WP_000035320.1.51152 WP_000035320.1.5117 WP_000035320.1.51194 WP_000035320.1.51209 WP_000035320.1.51220 WP_000035320.1.51236 WP_000035320.1.51245 WP_000035320.1.51250 WP_000035320.1.51271 WP_000035320.1.51277 WP_000035320.1.51306 WP_000035320.1.51326 WP_000035320.1.51346 WP_000035320.1.51365 WP_000035320.1.51376 WP_000035320.1.51377 WP_000035320.1.51393 WP_000035320.1.51403 WP_000035320.1.51418 WP_000035320.1.5145 WP_000035320.1.51456 WP_000035320.1.51465 WP_000035320.1.51469 WP_000035320.1.51492 WP_000035320.1.51496 WP_000035320.1.515 WP_000035320.1.51527 WP_000035320.1.5155 WP_000035320.1.51557 WP_000035320.1.51559 WP_000035320.1.51571 WP_000035320.1.51575 WP_000035320.1.51590 WP_000035320.1.51619 WP_000035320.1.51623 WP_000035320.1.51657 WP_000035320.1.51665 WP_000035320.1.51672 WP_000035320.1.51702 WP_000035320.1.51713 WP_000035320.1.51741 WP_000035320.1.51744 WP_000035320.1.51751 WP_000035320.1.51794 WP_000035320.1.51797 WP_000035320.1.51824 WP_000035320.1.51836 WP_000035320.1.51842 WP_000035320.1.51844 WP_000035320.1.5186 WP_000035320.1.51866 WP_000035320.1.51871 WP_000035320.1.51912 WP_000035320.1.51924 WP_000035320.1.51936 WP_000035320.1.51971 WP_000035320.1.52034 WP_000035320.1.52061 WP_000035320.1.52072 WP_000035320.1.5213 WP_000035320.1.52151 WP_000035320.1.52182 WP_000035320.1.52185 WP_000035320.1.52193 WP_000035320.1.52195 WP_000035320.1.52198 WP_000035320.1.52210 WP_000035320.1.52224 WP_000035320.1.52289 WP_000035320.1.52296 WP_000035320.1.523 WP_000035320.1.52308 WP_000035320.1.52322 WP_000035320.1.52327 WP_000035320.1.52331 WP_000035320.1.52340 WP_000035320.1.52343 WP_000035320.1.52377 WP_000035320.1.52396 WP_000035320.1.52423 WP_000035320.1.52427 WP_000035320.1.52440 WP_000035320.1.52442 WP_000035320.1.52452 WP_000035320.1.52463 WP_000035320.1.52474 WP_000035320.1.5251 WP_000035320.1.52511 WP_000035320.1.52548 WP_000035320.1.52602 WP_000035320.1.52605 WP_000035320.1.52622 WP_000035320.1.52623 WP_000035320.1.52624 WP_000035320.1.52633 WP_000035320.1.52645 WP_000035320.1.52660 WP_000035320.1.52670 WP_000035320.1.52687 WP_000035320.1.52699 WP_000035320.1.52715 WP_000035320.1.52722 WP_000035320.1.52751 WP_000035320.1.52828 WP_000035320.1.52830 WP_000035320.1.52848 WP_000035320.1.52865 WP_000035320.1.52877 WP_000035320.1.52878 WP_000035320.1.52886 WP_000035320.1.52889 WP_000035320.1.52900 WP_000035320.1.52941 WP_000035320.1.52965 WP_000035320.1.52983 WP_000035320.1.52984 WP_000035320.1.52992 WP_000035320.1.53002 WP_000035320.1.53022 WP_000035320.1.5304 WP_000035320.1.53050 WP_000035320.1.53057 WP_000035320.1.53060 WP_000035320.1.53069 WP_000035320.1.53071 WP_000035320.1.53109 WP_000035320.1.53140 WP_000035320.1.53178 WP_000035320.1.5319 WP_000035320.1.53209 WP_000035320.1.5323 WP_000035320.1.53245 WP_000035320.1.53260 WP_000035320.1.53312 WP_000035320.1.53317 WP_000035320.1.53319 WP_000035320.1.53323 WP_000035320.1.53352 WP_000035320.1.5336 WP_000035320.1.53363 WP_000035320.1.53366 WP_000035320.1.53372 WP_000035320.1.53373 WP_000035320.1.53379 WP_000035320.1.53383 WP_000035320.1.53387 WP_000035320.1.53394 WP_000035320.1.53403 WP_000035320.1.53408 WP_000035320.1.53418 WP_000035320.1.53432 WP_000035320.1.53433 WP_000035320.1.53444 WP_000035320.1.53452 WP_000035320.1.53462 WP_000035320.1.53467 WP_000035320.1.5347 WP_000035320.1.53488 WP_000035320.1.53503 WP_000035320.1.53521 WP_000035320.1.53532 WP_000035320.1.53641 WP_000035320.1.53648 WP_000035320.1.53671 WP_000035320.1.53691 WP_000035320.1.53758 WP_000035320.1.53759 WP_000035320.1.53774 WP_000035320.1.53799 WP_000035320.1.5382 WP_000035320.1.53827 WP_000035320.1.53835 WP_000035320.1.53889 WP_000035320.1.53911 WP_000035320.1.53924 WP_000035320.1.53926 WP_000035320.1.53934 WP_000035320.1.53969 WP_000035320.1.53999 WP_000035320.1.5401 WP_000035320.1.54049 WP_000035320.1.54074 WP_000035320.1.54086 WP_000035320.1.54094 WP_000035320.1.54109 WP_000035320.1.54147 WP_000035320.1.54199 WP_000035320.1.54237 WP_000035320.1.54253 WP_000035320.1.54282 WP_000035320.1.54290 WP_000035320.1.54297 WP_000035320.1.54299 WP_000035320.1.54332 WP_000035320.1.54373 WP_000035320.1.54395 WP_000035320.1.54404 WP_000035320.1.54413 WP_000035320.1.54426 WP_000035320.1.54438 WP_000035320.1.54446 WP_000035320.1.54471 WP_000035320.1.54479 WP_000035320.1.54485 WP_000035320.1.54491 WP_000035320.1.54510 WP_000035320.1.54518 WP_000035320.1.54539 WP_000035320.1.54543 WP_000035320.1.54554 WP_000035320.1.54572 WP_000035320.1.54574 WP_000035320.1.54637 WP_000035320.1.54675 WP_000035320.1.54733 WP_000035320.1.54744 WP_000035320.1.54745 WP_000035320.1.54753 WP_000035320.1.54819 WP_000035320.1.54826 WP_000035320.1.54830 WP_000035320.1.54851 WP_000035320.1.54878 WP_000035320.1.54929 WP_000035320.1.54931 WP_000035320.1.54955 WP_000035320.1.54967 WP_000035320.1.54990 WP_000035320.1.5500 WP_000035320.1.55004 WP_000035320.1.55014 WP_000035320.1.55058 WP_000035320.1.55082 WP_000035320.1.55084 WP_000035320.1.55095 WP_000035320.1.55100 WP_000035320.1.55139 WP_000035320.1.5518 WP_000035320.1.5519 WP_000035320.1.55192 WP_000035320.1.552 WP_000035320.1.55214 WP_000035320.1.55220 WP_000035320.1.55239 WP_000035320.1.55271 WP_000035320.1.55274 WP_000035320.1.55301 WP_000035320.1.55306 WP_000035320.1.55309 WP_000035320.1.55327 WP_000035320.1.55336 WP_000035320.1.5536 WP_000035320.1.55367 WP_000035320.1.55369 WP_000035320.1.55419 WP_000035320.1.55421 WP_000035320.1.55442 WP_000035320.1.55495 WP_000035320.1.5550 WP_000035320.1.55508 WP_000035320.1.55527 WP_000035320.1.55535 WP_000035320.1.55538 WP_000035320.1.5554 WP_000035320.1.55558 WP_000035320.1.5556 WP_000035320.1.55573 WP_000035320.1.55583 WP_000035320.1.5559 WP_000035320.1.55603 WP_000035320.1.55628 WP_000035320.1.55637 WP_000035320.1.55657 WP_000035320.1.557 WP_000035320.1.55717 WP_000035320.1.55719 WP_000035320.1.55724 WP_000035320.1.55728 WP_000035320.1.55746 WP_000035320.1.55784 WP_000035320.1.55818 WP_000035320.1.55831 WP_000035320.1.55835 WP_000035320.1.55845 WP_000035320.1.55854 WP_000035320.1.55867 WP_000035320.1.55874 WP_000035320.1.55886 WP_000035320.1.5589 WP_000035320.1.5590 WP_000035320.1.55933 WP_000035320.1.55949 WP_000035320.1.55953 WP_000035320.1.55955 WP_000035320.1.55960 WP_000035320.1.55985 WP_000035320.1.56000 WP_000035320.1.56003 WP_000035320.1.56039 WP_000035320.1.5604 WP_000035320.1.56048 WP_000035320.1.56064 WP_000035320.1.56078 WP_000035320.1.56098 WP_000035320.1.56106 WP_000035320.1.56135 WP_000035320.1.56153 WP_000035320.1.56159 WP_000035320.1.56214 WP_000035320.1.56220 WP_000035320.1.56225 WP_000035320.1.56237 WP_000035320.1.56239 WP_000035320.1.56265 WP_000035320.1.56281 WP_000035320.1.56343 WP_000035320.1.5635 WP_000035320.1.5637 WP_000035320.1.56387 WP_000035320.1.56400 WP_000035320.1.5644 WP_000035320.1.56453 WP_000035320.1.56464 WP_000035320.1.56482 WP_000035320.1.56496 WP_000035320.1.56527 WP_000035320.1.56530 WP_000035320.1.56542 WP_000035320.1.56558 WP_000035320.1.56570 WP_000035320.1.56598 WP_000035320.1.566 WP_000035320.1.56608 WP_000035320.1.56619 WP_000035320.1.56628 WP_000035320.1.56641 WP_000035320.1.5665 WP_000035320.1.56658 WP_000035320.1.5666 WP_000035320.1.56702 WP_000035320.1.56708 WP_000035320.1.56723 WP_000035320.1.56737 WP_000035320.1.5675 WP_000035320.1.5677 WP_000035320.1.56778 WP_000035320.1.56779 WP_000035320.1.56806 WP_000035320.1.56815 WP_000035320.1.56822 WP_000035320.1.56856 WP_000035320.1.5686 WP_000035320.1.56865 WP_000035320.1.56878 WP_000035320.1.569 WP_000035320.1.56903 WP_000035320.1.56931 WP_000035320.1.56966 WP_000035320.1.56975 WP_000035320.1.56986 WP_000035320.1.57015 WP_000035320.1.57047 WP_000035320.1.5705 WP_000035320.1.57073 WP_000035320.1.57075 WP_000035320.1.57080 WP_000035320.1.57081 WP_000035320.1.57097 WP_000035320.1.57109 WP_000035320.1.57115 WP_000035320.1.57141 WP_000035320.1.57170 WP_000035320.1.57175 WP_000035320.1.5718 WP_000035320.1.57190 WP_000035320.1.57196 WP_000035320.1.57214 WP_000035320.1.57223 WP_000035320.1.57316 WP_000035320.1.57330 WP_000035320.1.57338 WP_000035320.1.57370 WP_000035320.1.57376 WP_000035320.1.57389 WP_000035320.1.57427 WP_000035320.1.57448 WP_000035320.1.57459 WP_000035320.1.57481 WP_000035320.1.5749 WP_000035320.1.57507 WP_000035320.1.5752 WP_000035320.1.57577 WP_000035320.1.57593 WP_000035320.1.57594 WP_000035320.1.5763 WP_000035320.1.57650 WP_000035320.1.57665 WP_000035320.1.57670 WP_000035320.1.57682 WP_000035320.1.57693 WP_000035320.1.5770 WP_000035320.1.57701 WP_000035320.1.57718 WP_000035320.1.57720 WP_000035320.1.57723 WP_000035320.1.57727 WP_000035320.1.57730 WP_000035320.1.57734 WP_000035320.1.57745 WP_000035320.1.57754 WP_000035320.1.57761 WP_000035320.1.57770 WP_000035320.1.57783 WP_000035320.1.57808 WP_000035320.1.57837 WP_000035320.1.57840 WP_000035320.1.57844 WP_000035320.1.57861 WP_000035320.1.57878 WP_000035320.1.57888 WP_000035320.1.579 WP_000035320.1.5791 WP_000035320.1.57910 WP_000035320.1.57915 WP_000035320.1.57943 WP_000035320.1.57944 WP_000035320.1.57952 WP_000035320.1.57962 WP_000035320.1.5799 WP_000035320.1.58005 WP_000035320.1.58006 WP_000035320.1.58014 WP_000035320.1.58016 WP_000035320.1.58017 WP_000035320.1.58035 WP_000035320.1.58049 WP_000035320.1.58050 WP_000035320.1.58051 WP_000035320.1.58074 WP_000035320.1.58116 WP_000035320.1.58122 WP_000035320.1.58127 WP_000035320.1.58148 WP_000035320.1.58158 WP_000035320.1.5817 WP_000035320.1.58175 WP_000035320.1.58185 WP_000035320.1.58198 WP_000035320.1.58212 WP_000035320.1.58241 WP_000035320.1.58246 WP_000035320.1.58277 WP_000035320.1.58321 WP_000035320.1.58325 WP_000035320.1.58350 WP_000035320.1.58352 WP_000035320.1.58353 WP_000035320.1.58364 WP_000035320.1.58366 WP_000035320.1.58373 WP_000035320.1.58388 WP_000035320.1.58392 WP_000035320.1.58395 WP_000035320.1.58413 WP_000035320.1.58419 WP_000035320.1.58421 WP_000035320.1.58435 WP_000035320.1.58473 WP_000035320.1.58481 WP_000035320.1.5849 WP_000035320.1.58495 WP_000035320.1.58497 WP_000035320.1.58508 WP_000035320.1.58512 WP_000035320.1.58521 WP_000035320.1.58530 WP_000035320.1.58538 WP_000035320.1.58549 WP_000035320.1.5857 WP_000035320.1.58571 WP_000035320.1.58598 WP_000035320.1.586 WP_000035320.1.58603 WP_000035320.1.58686 WP_000035320.1.58701 WP_000035320.1.58704 WP_000035320.1.58714 WP_000035320.1.58760 WP_000035320.1.58763 WP_000035320.1.58772 WP_000035320.1.58775 WP_000035320.1.58798 WP_000035320.1.58833 WP_000035320.1.58855 WP_000035320.1.58936 WP_000035320.1.58981 WP_000035320.1.58991 WP_000035320.1.5901 WP_000035320.1.59011 WP_000035320.1.59014 WP_000035320.1.5904 WP_000035320.1.59062 WP_000035320.1.59077 WP_000035320.1.59098 WP_000035320.1.59124 WP_000035320.1.59133 WP_000035320.1.59135 WP_000035320.1.59146 WP_000035320.1.59187 WP_000035320.1.5920 WP_000035320.1.59203 WP_000035320.1.59213 WP_000035320.1.5925 WP_000035320.1.59269 WP_000035320.1.59284 WP_000035320.1.59327 WP_000035320.1.59329 WP_000035320.1.59337 WP_000035320.1.59363 WP_000035320.1.5938 WP_000035320.1.59380 WP_000035320.1.59397 WP_000035320.1.59398 WP_000035320.1.5940 WP_000035320.1.59401 WP_000035320.1.59404 WP_000035320.1.59441 WP_000035320.1.59457 WP_000035320.1.59459 WP_000035320.1.59462 WP_000035320.1.59464 WP_000035320.1.59467 WP_000035320.1.59478 WP_000035320.1.59489 WP_000035320.1.59498 WP_000035320.1.59540 WP_000035320.1.59546 WP_000035320.1.59547 WP_000035320.1.59598 WP_000035320.1.59603 WP_000035320.1.59609 WP_000035320.1.59624 WP_000035320.1.59629 WP_000035320.1.59643 WP_000035320.1.59663 WP_000035320.1.59668 WP_000035320.1.59669 WP_000035320.1.59671 WP_000035320.1.59697 WP_000035320.1.59736 WP_000035320.1.59787 WP_000035320.1.59803 WP_000035320.1.59819 WP_000035320.1.5982 WP_000035320.1.59822 WP_000035320.1.59881 WP_000035320.1.59886 WP_000035320.1.59896 WP_000035320.1.59907 WP_000035320.1.59921 WP_000035320.1.59945 WP_000035320.1.59977 WP_000035320.1.60001 WP_000035320.1.60006 WP_000035320.1.6006 WP_000035320.1.60086 WP_000035320.1.60101 WP_000035320.1.60107 WP_000035320.1.60123 WP_000035320.1.60124 WP_000035320.1.60147 WP_000035320.1.60149 WP_000035320.1.6017 WP_000035320.1.60181 WP_000035320.1.60201 WP_000035320.1.60227 WP_000035320.1.60251 WP_000035320.1.60259 WP_000035320.1.60280 WP_000035320.1.60307 WP_000035320.1.6034 WP_000035320.1.60345 WP_000035320.1.60353 WP_000035320.1.60360 WP_000035320.1.60368 WP_000035320.1.60382 WP_000035320.1.60414 WP_000035320.1.60431 WP_000035320.1.60434 WP_000035320.1.60462 WP_000035320.1.60473 WP_000035320.1.60492 WP_000035320.1.60493 WP_000035320.1.60515 WP_000035320.1.60530 WP_000035320.1.60547 WP_000035320.1.60551 WP_000035320.1.60585 WP_000035320.1.60594 WP_000035320.1.60595 WP_000035320.1.60636 WP_000035320.1.60675 WP_000035320.1.60677 WP_000035320.1.60690 WP_000035320.1.60696 WP_000035320.1.60734 WP_000035320.1.60750 WP_000035320.1.60751 WP_000035320.1.60758 WP_000035320.1.60759 WP_000035320.1.60765 WP_000035320.1.60787 WP_000035320.1.60813 WP_000035320.1.60820 WP_000035320.1.60845 WP_000035320.1.6085 WP_000035320.1.60898 WP_000035320.1.60912 WP_000035320.1.60917 WP_000035320.1.60923 WP_000035320.1.60939 WP_000035320.1.60943 WP_000035320.1.60946 WP_000035320.1.60949 WP_000035320.1.60965 WP_000035320.1.60981 WP_000035320.1.60982 WP_000035320.1.60991 WP_000035320.1.61009 WP_000035320.1.61013 WP_000035320.1.61023 WP_000035320.1.61026 WP_000035320.1.61029 WP_000035320.1.61030 WP_000035320.1.61031 WP_000035320.1.61077 WP_000035320.1.61082 WP_000035320.1.61115 WP_000035320.1.61119 WP_000035320.1.61152 WP_000035320.1.61153 WP_000035320.1.6118 WP_000035320.1.61187 WP_000035320.1.61188 WP_000035320.1.6119 WP_000035320.1.61215 WP_000035320.1.61224 WP_000035320.1.61257 WP_000035320.1.61261 WP_000035320.1.61263 WP_000035320.1.61277 WP_000035320.1.61286 WP_000035320.1.61289 WP_000035320.1.61313 WP_000035320.1.61316 WP_000035320.1.61324 WP_000035320.1.61327 WP_000035320.1.61339 WP_000035320.1.61353 WP_000035320.1.6136 WP_000035320.1.61393 WP_000035320.1.61394 WP_000035320.1.61408 WP_000035320.1.61413 WP_000035320.1.61421 WP_000035320.1.61430 WP_000035320.1.61439 WP_000035320.1.61440 WP_000035320.1.61547 WP_000035320.1.61555 WP_000035320.1.61564 WP_000035320.1.61585 WP_000035320.1.61591 WP_000035320.1.61597 WP_000035320.1.61615 WP_000035320.1.61639 WP_000035320.1.61641 WP_000035320.1.6166 WP_000035320.1.6168 WP_000035320.1.61687 WP_000035320.1.6170 WP_000035320.1.61705 WP_000035320.1.61747 WP_000035320.1.61784 WP_000035320.1.61800 WP_000035320.1.61802 WP_000035320.1.61831 WP_000035320.1.61838 WP_000035320.1.61864 WP_000035320.1.6189 WP_000035320.1.61897 WP_000035320.1.619 WP_000035320.1.61903 WP_000035320.1.61921 WP_000035320.1.61936 WP_000035320.1.61970 WP_000035320.1.61975 WP_000035320.1.61978 WP_000035320.1.62002 WP_000035320.1.62030 WP_000035320.1.62071 WP_000035320.1.6208 WP_000035320.1.62084 WP_000035320.1.62085 WP_000035320.1.62088 WP_000035320.1.62093 WP_000035320.1.62096 WP_000035320.1.62140 WP_000035320.1.62160 WP_000035320.1.62164 WP_000035320.1.62229 WP_000035320.1.62247 WP_000035320.1.62254 WP_000035320.1.62265 WP_000035320.1.62318 WP_000035320.1.6234 WP_000035320.1.62352 WP_000035320.1.62367 WP_000035320.1.62382 WP_000035320.1.62383 WP_000035320.1.62409 WP_000035320.1.62414 WP_000035320.1.62429 WP_000035320.1.62437 WP_000035320.1.62459 WP_000035320.1.62474 WP_000035320.1.62482 WP_000035320.1.62492 WP_000035320.1.62496 WP_000035320.1.6250 WP_000035320.1.62537 WP_000035320.1.62539 WP_000035320.1.62553 WP_000035320.1.62575 WP_000035320.1.62602 WP_000035320.1.62608 WP_000035320.1.62630 WP_000035320.1.62653 WP_000035320.1.62671 WP_000035320.1.6268 WP_000035320.1.62684 WP_000035320.1.62685 WP_000035320.1.62723 WP_000035320.1.62740 WP_000035320.1.62756 WP_000035320.1.62764 WP_000035320.1.62771 WP_000035320.1.62781 WP_000035320.1.62796 WP_000035320.1.62808 WP_000035320.1.62822 WP_000035320.1.62824 WP_000035320.1.62829 WP_000035320.1.62831 WP_000035320.1.62842 WP_000035320.1.62860 WP_000035320.1.62863 WP_000035320.1.62878 WP_000035320.1.62927 WP_000035320.1.62956 WP_000035320.1.62974 WP_000035320.1.6298 WP_000035320.1.62998 WP_000035320.1.63003 WP_000035320.1.63004 WP_000035320.1.63011 WP_000035320.1.63027 WP_000035320.1.63050 WP_000035320.1.63052 WP_000035320.1.63062 WP_000035320.1.63068 WP_000035320.1.63070 WP_000035320.1.63083 WP_000035320.1.63085 WP_000035320.1.631 WP_000035320.1.63131 WP_000035320.1.63132 WP_000035320.1.63139 WP_000035320.1.63140 WP_000035320.1.63142 WP_000035320.1.63162 WP_000035320.1.63170 WP_000035320.1.63182 WP_000035320.1.63195 WP_000035320.1.63215 WP_000035320.1.63220 WP_000035320.1.63233 WP_000035320.1.63244 WP_000035320.1.63266 WP_000035320.1.63273 WP_000035320.1.63279 WP_000035320.1.63280 WP_000035320.1.63289 WP_000035320.1.63296 WP_000035320.1.63304 WP_000035320.1.63307 WP_000035320.1.63313 WP_000035320.1.63319 WP_000035320.1.63322 WP_000035320.1.63324 WP_000035320.1.63333 WP_000035320.1.63335 WP_000035320.1.63337 WP_000035320.1.63341 WP_000035320.1.63364 WP_000035320.1.63365 WP_000035320.1.63383 WP_000035320.1.63406 WP_000035320.1.63411 WP_000035320.1.63421 WP_000035320.1.63441 WP_000035320.1.63460 WP_000035320.1.63469 WP_000035320.1.63471 WP_000035320.1.63510 WP_000035320.1.63527 WP_000035320.1.63565 WP_000035320.1.63589 WP_000035320.1.63617 WP_000035320.1.63673 WP_000035320.1.63678 WP_000035320.1.63693 WP_000035320.1.63705 WP_000035320.1.63726 WP_000035320.1.63729 WP_000035320.1.6374 WP_000035320.1.63751 WP_000035320.1.63759 WP_000035320.1.63760 WP_000035320.1.6378 WP_000035320.1.63828 WP_000035320.1.63847 WP_000035320.1.63874 WP_000035320.1.6388 WP_000035320.1.63894 WP_000035320.1.63895 WP_000035320.1.63907 WP_000035320.1.63910 WP_000035320.1.63937 WP_000035320.1.63975 WP_000035320.1.63987 WP_000035320.1.64012 WP_000035320.1.6408 WP_000035320.1.64094 WP_000035320.1.64108 WP_000035320.1.6412 WP_000035320.1.64192 WP_000035320.1.64207 WP_000035320.1.64230 WP_000035320.1.64250 WP_000035320.1.64251 WP_000035320.1.64279 WP_000035320.1.64303 WP_000035320.1.64304 WP_000035320.1.64334 WP_000035320.1.64351 WP_000035320.1.64367 WP_000035320.1.64368 WP_000035320.1.6438 WP_000035320.1.64397 WP_000035320.1.64400 WP_000035320.1.64440 WP_000035320.1.64456 WP_000035320.1.64457 WP_000035320.1.64473 WP_000035320.1.64525 WP_000035320.1.64549 WP_000035320.1.64565 WP_000035320.1.6459 WP_000035320.1.64598 WP_000035320.1.6462 WP_000035320.1.64628 WP_000035320.1.64630 WP_000035320.1.64631 WP_000035320.1.64643 WP_000035320.1.64665 WP_000035320.1.64677 WP_000035320.1.64686 WP_000035320.1.64765 WP_000035320.1.6479 WP_000035320.1.64811 WP_000035320.1.64845 WP_000035320.1.64858 WP_000035320.1.64860 WP_000035320.1.64873 WP_000035320.1.64879 WP_000035320.1.64896 WP_000035320.1.64897 WP_000035320.1.64899 WP_000035320.1.64928 WP_000035320.1.64951 WP_000035320.1.64956 WP_000035320.1.64994 WP_000035320.1.64996 WP_000035320.1.64998 WP_000035320.1.65025 WP_000035320.1.65033 WP_000035320.1.65038 WP_000035320.1.65044 WP_000035320.1.65046 WP_000035320.1.65076 WP_000035320.1.65082 WP_000035320.1.65125 WP_000035320.1.65132 WP_000035320.1.65153 WP_000035320.1.65156 WP_000035320.1.65158 WP_000035320.1.65180 WP_000035320.1.65193 WP_000035320.1.65203 WP_000035320.1.65214 WP_000035320.1.65217 WP_000035320.1.65233 WP_000035320.1.65243 WP_000035320.1.65259 WP_000035320.1.65264 WP_000035320.1.6531 WP_000035320.1.65317 WP_000035320.1.65361 WP_000035320.1.65367 WP_000035320.1.65387 WP_000035320.1.65406 WP_000035320.1.65407 WP_000035320.1.65419 WP_000035320.1.65423 WP_000035320.1.65432 WP_000035320.1.6544 WP_000035320.1.65443 WP_000035320.1.65448 WP_000035320.1.65470 WP_000035320.1.65504 WP_000035320.1.6551 WP_000035320.1.65541 WP_000035320.1.65544 WP_000035320.1.65555 WP_000035320.1.65562 WP_000035320.1.65585 WP_000035320.1.65616 WP_000035320.1.65629 WP_000035320.1.65643 WP_000035320.1.65653 WP_000035320.1.65656 WP_000035320.1.65663 WP_000035320.1.6568 WP_000035320.1.65693 WP_000035320.1.65700 WP_000035320.1.65703 WP_000035320.1.65705 WP_000035320.1.65713 WP_000035320.1.65734 WP_000035320.1.65750 WP_000035320.1.65752 WP_000035320.1.65769 WP_000035320.1.65808 WP_000035320.1.65809 WP_000035320.1.65842 WP_000035320.1.6585 WP_000035320.1.65856 WP_000035320.1.65892 WP_000035320.1.65922 WP_000035320.1.65931 WP_000035320.1.65935 WP_000035320.1.65947 WP_000035320.1.65948 WP_000035320.1.65965 WP_000035320.1.66009 WP_000035320.1.6603 WP_000035320.1.66035 WP_000035320.1.66054 WP_000035320.1.66069 WP_000035320.1.66073 WP_000035320.1.66081 WP_000035320.1.661 WP_000035320.1.6612 WP_000035320.1.66120 WP_000035320.1.66130 WP_000035320.1.66133 WP_000035320.1.66144 WP_000035320.1.66262 WP_000035320.1.66265 WP_000035320.1.66281 WP_000035320.1.66287 WP_000035320.1.66298 WP_000035320.1.66302 WP_000035320.1.6632 WP_000035320.1.66366 WP_000035320.1.66369 WP_000035320.1.66433 WP_000035320.1.66453 WP_000035320.1.66505 WP_000035320.1.66513 WP_000035320.1.66519 WP_000035320.1.66542 WP_000035320.1.66554 WP_000035320.1.66556 WP_000035320.1.66564 WP_000035320.1.66576 WP_000035320.1.66588 WP_000035320.1.66598 WP_000035320.1.66601 WP_000035320.1.66606 WP_000035320.1.66611 WP_000035320.1.66614 WP_000035320.1.6662 WP_000035320.1.66655 WP_000035320.1.66677 WP_000035320.1.66705 WP_000035320.1.66711 WP_000035320.1.66712 WP_000035320.1.66726 WP_000035320.1.6674 WP_000035320.1.66756 WP_000035320.1.66786 WP_000035320.1.66803 WP_000035320.1.66816 WP_000035320.1.66818 WP_000035320.1.6684 WP_000035320.1.6688 WP_000035320.1.66938 WP_000035320.1.66969 WP_000035320.1.66979 WP_000035320.1.6700 WP_000035320.1.67006 WP_000035320.1.67012 WP_000035320.1.67014 WP_000035320.1.67067 WP_000035320.1.67072 WP_000035320.1.67090 WP_000035320.1.67112 WP_000035320.1.67113 WP_000035320.1.67135 WP_000035320.1.67155 WP_000035320.1.67160 WP_000035320.1.67204 WP_000035320.1.6722 WP_000035320.1.67238 WP_000035320.1.67251 WP_000035320.1.67259 WP_000035320.1.6726 WP_000035320.1.67266 WP_000035320.1.67286 WP_000035320.1.67294 WP_000035320.1.67296 WP_000035320.1.67297 WP_000035320.1.67312 WP_000035320.1.67333 WP_000035320.1.67386 WP_000035320.1.6740 WP_000035320.1.67414 WP_000035320.1.67418 WP_000035320.1.67420 WP_000035320.1.67425 WP_000035320.1.67447 WP_000035320.1.67457 WP_000035320.1.67460 WP_000035320.1.67463 WP_000035320.1.67480 WP_000035320.1.67505 WP_000035320.1.67507 WP_000035320.1.67513 WP_000035320.1.67520 WP_000035320.1.67540 WP_000035320.1.67554 WP_000035320.1.67571 WP_000035320.1.67572 WP_000035320.1.67609 WP_000035320.1.67612 WP_000035320.1.67618 WP_000035320.1.67621 WP_000035320.1.67644 WP_000035320.1.67651 WP_000035320.1.67652 WP_000035320.1.67653 WP_000035320.1.67691 WP_000035320.1.67703 WP_000035320.1.67712 WP_000035320.1.67713 WP_000035320.1.67722 WP_000035320.1.67752 WP_000035320.1.67762 WP_000035320.1.67767 WP_000035320.1.67806 WP_000035320.1.67815 WP_000035320.1.67834 WP_000035320.1.67865 WP_000035320.1.67867 WP_000035320.1.67880 WP_000035320.1.67889 WP_000035320.1.67900 WP_000035320.1.67925 WP_000035320.1.67941 WP_000035320.1.67986 WP_000035320.1.67991 WP_000035320.1.68001 WP_000035320.1.68033 WP_000035320.1.68054 WP_000035320.1.68066 WP_000035320.1.68101 WP_000035320.1.68102 WP_000035320.1.68111 WP_000035320.1.68134 WP_000035320.1.68139 WP_000035320.1.68141 WP_000035320.1.68152 WP_000035320.1.68160 WP_000035320.1.68161 WP_000035320.1.68199 WP_000035320.1.68202 WP_000035320.1.68219 WP_000035320.1.68221 WP_000035320.1.68223 WP_000035320.1.6824 WP_000035320.1.68261 WP_000035320.1.68268 WP_000035320.1.68296 WP_000035320.1.68299 WP_000035320.1.6830 WP_000035320.1.68307 WP_000035320.1.6834 WP_000035320.1.68343 WP_000035320.1.68355 WP_000035320.1.68366 WP_000035320.1.68367 WP_000035320.1.6839 WP_000035320.1.68397 WP_000035320.1.68398 WP_000035320.1.68404 WP_000035320.1.68416 WP_000035320.1.68425 WP_000035320.1.68476 WP_000035320.1.68479 WP_000035320.1.68483 WP_000035320.1.68489 WP_000035320.1.68504 WP_000035320.1.68505 WP_000035320.1.68512 WP_000035320.1.68522 WP_000035320.1.68542 WP_000035320.1.68548 WP_000035320.1.68565 WP_000035320.1.68575 WP_000035320.1.686 WP_000035320.1.68636 WP_000035320.1.68650 WP_000035320.1.68681 WP_000035320.1.68683 WP_000035320.1.68699 WP_000035320.1.68703 WP_000035320.1.68737 WP_000035320.1.68741 WP_000035320.1.68743 WP_000035320.1.68775 WP_000035320.1.68813 WP_000035320.1.68831 WP_000035320.1.68854 WP_000035320.1.68864 WP_000035320.1.68875 WP_000035320.1.68883 WP_000035320.1.68917 WP_000035320.1.68943 WP_000035320.1.68944 WP_000035320.1.68998 WP_000035320.1.69012 WP_000035320.1.69045 WP_000035320.1.69071 WP_000035320.1.69078 WP_000035320.1.69089 WP_000035320.1.69105 WP_000035320.1.69110 WP_000035320.1.69111 WP_000035320.1.69125 WP_000035320.1.69147 WP_000035320.1.6915 WP_000035320.1.6917 WP_000035320.1.69179 WP_000035320.1.69198 WP_000035320.1.69213 WP_000035320.1.69219 WP_000035320.1.69222 WP_000035320.1.69232 WP_000035320.1.69237 WP_000035320.1.69239 WP_000035320.1.69251 WP_000035320.1.69280 WP_000035320.1.69314 WP_000035320.1.69349 WP_000035320.1.69361 WP_000035320.1.69366 WP_000035320.1.69378 WP_000035320.1.69394 WP_000035320.1.69395 WP_000035320.1.69415 WP_000035320.1.69434 WP_000035320.1.69437 WP_000035320.1.69446 WP_000035320.1.69475 WP_000035320.1.69477 WP_000035320.1.69480 WP_000035320.1.69484 WP_000035320.1.69490 WP_000035320.1.695 WP_000035320.1.6953 WP_000035320.1.69546 WP_000035320.1.69552 WP_000035320.1.69559 WP_000035320.1.69563 WP_000035320.1.69598 WP_000035320.1.69622 WP_000035320.1.69679 WP_000035320.1.6968 WP_000035320.1.69683 WP_000035320.1.69685 WP_000035320.1.69718 WP_000035320.1.69724 WP_000035320.1.69734 WP_000035320.1.6980 WP_000035320.1.69820 WP_000035320.1.69823 WP_000035320.1.69830 WP_000035320.1.69842 WP_000035320.1.69877 WP_000035320.1.69878 WP_000035320.1.69882 WP_000035320.1.699 WP_000035320.1.69902 WP_000035320.1.69921 WP_000035320.1.69934 WP_000035320.1.69980 WP_000035320.1.69987 WP_000035320.1.69995 WP_000035320.1.70024 WP_000035320.1.70048 WP_000035320.1.70059 WP_000035320.1.70089 WP_000035320.1.70105 WP_000035320.1.7012 WP_000035320.1.70133 WP_000035320.1.70161 WP_000035320.1.70210 WP_000035320.1.70220 WP_000035320.1.70225 WP_000035320.1.70228 WP_000035320.1.70253 WP_000035320.1.70273 WP_000035320.1.70294 WP_000035320.1.703 WP_000035320.1.7030 WP_000035320.1.70311 WP_000035320.1.70313 WP_000035320.1.70334 WP_000035320.1.70338 WP_000035320.1.7034 WP_000035320.1.70353 WP_000035320.1.70361 WP_000035320.1.70389 WP_000035320.1.7043 WP_000035320.1.70438 WP_000035320.1.70448 WP_000035320.1.70451 WP_000035320.1.7046 WP_000035320.1.70462 WP_000035320.1.70487 WP_000035320.1.70495 WP_000035320.1.70527 WP_000035320.1.7053 WP_000035320.1.70546 WP_000035320.1.70554 WP_000035320.1.70558 WP_000035320.1.70564 WP_000035320.1.70572 WP_000035320.1.7061 WP_000035320.1.70611 WP_000035320.1.70635 WP_000035320.1.7064 WP_000035320.1.70641 WP_000035320.1.70651 WP_000035320.1.7067 WP_000035320.1.707 WP_000035320.1.7071 WP_000035320.1.70721 WP_000035320.1.7073 WP_000035320.1.70763 WP_000035320.1.70790 WP_000035320.1.70791 WP_000035320.1.70808 WP_000035320.1.70818 WP_000035320.1.70823 WP_000035320.1.70829 WP_000035320.1.70835 WP_000035320.1.70843 WP_000035320.1.70855 WP_000035320.1.7089 WP_000035320.1.70909 WP_000035320.1.70917 WP_000035320.1.70924 WP_000035320.1.70926 WP_000035320.1.70930 WP_000035320.1.70939 WP_000035320.1.710 WP_000035320.1.71016 WP_000035320.1.71043 WP_000035320.1.7105 WP_000035320.1.71058 WP_000035320.1.71059 WP_000035320.1.7109 WP_000035320.1.711 WP_000035320.1.71130 WP_000035320.1.71143 WP_000035320.1.71180 WP_000035320.1.71182 WP_000035320.1.7120 WP_000035320.1.71208 WP_000035320.1.71231 WP_000035320.1.71236 WP_000035320.1.7125 WP_000035320.1.71256 WP_000035320.1.71257 WP_000035320.1.71267 WP_000035320.1.71295 WP_000035320.1.71298 WP_000035320.1.71313 WP_000035320.1.71325 WP_000035320.1.71332 WP_000035320.1.71345 WP_000035320.1.71351 WP_000035320.1.71359 WP_000035320.1.71410 WP_000035320.1.71416 WP_000035320.1.71419 WP_000035320.1.71431 WP_000035320.1.71463 WP_000035320.1.71466 WP_000035320.1.71467 WP_000035320.1.71475 WP_000035320.1.7150 WP_000035320.1.71521 WP_000035320.1.71529 WP_000035320.1.71543 WP_000035320.1.71572 WP_000035320.1.71575 WP_000035320.1.7158 WP_000035320.1.71590 WP_000035320.1.71596 WP_000035320.1.71602 WP_000035320.1.7161 WP_000035320.1.71644 WP_000035320.1.71662 WP_000035320.1.71676 WP_000035320.1.71715 WP_000035320.1.71721 WP_000035320.1.71735 WP_000035320.1.71737 WP_000035320.1.71739 WP_000035320.1.71741 WP_000035320.1.71772 WP_000035320.1.71780 WP_000035320.1.71788 WP_000035320.1.71859 WP_000035320.1.71861 WP_000035320.1.71863 WP_000035320.1.71877 WP_000035320.1.71888 WP_000035320.1.71892 WP_000035320.1.71899 WP_000035320.1.71910 WP_000035320.1.71925 WP_000035320.1.71949 WP_000035320.1.71978 WP_000035320.1.7198 WP_000035320.1.72002 WP_000035320.1.72018 WP_000035320.1.72026 WP_000035320.1.72035 WP_000035320.1.72067 WP_000035320.1.72085 WP_000035320.1.72089 WP_000035320.1.72099 WP_000035320.1.72112 WP_000035320.1.72148 WP_000035320.1.72176 WP_000035320.1.722 WP_000035320.1.72204 WP_000035320.1.72205 WP_000035320.1.72271 WP_000035320.1.72306 WP_000035320.1.72330 WP_000035320.1.72340 WP_000035320.1.7236 WP_000035320.1.72363 WP_000035320.1.72366 WP_000035320.1.72371 WP_000035320.1.7242 WP_000035320.1.72424 WP_000035320.1.72433 WP_000035320.1.72453 WP_000035320.1.72465 WP_000035320.1.72478 WP_000035320.1.72497 WP_000035320.1.7254 WP_000035320.1.72547 WP_000035320.1.72564 WP_000035320.1.7258 WP_000035320.1.7260 WP_000035320.1.72649 WP_000035320.1.72654 WP_000035320.1.72666 WP_000035320.1.72708 WP_000035320.1.72719 WP_000035320.1.72750 WP_000035320.1.72753 WP_000035320.1.72762 WP_000035320.1.7278 WP_000035320.1.72787 WP_000035320.1.72816 WP_000035320.1.72832 WP_000035320.1.72834 WP_000035320.1.72835 WP_000035320.1.72881 WP_000035320.1.72903 WP_000035320.1.72904 WP_000035320.1.7292 WP_000035320.1.72930 WP_000035320.1.72935 WP_000035320.1.72961 WP_000035320.1.72965 WP_000035320.1.72991 WP_000035320.1.73002 WP_000035320.1.73004 WP_000035320.1.73017 WP_000035320.1.73019 WP_000035320.1.73021 WP_000035320.1.73022 WP_000035320.1.73037 WP_000035320.1.73074 WP_000035320.1.73087 WP_000035320.1.73122 WP_000035320.1.73140 WP_000035320.1.73190 WP_000035320.1.73195 WP_000035320.1.73201 WP_000035320.1.73211 WP_000035320.1.73240 WP_000035320.1.73241 WP_000035320.1.73246 WP_000035320.1.73264 WP_000035320.1.73265 WP_000035320.1.73312 WP_000035320.1.73386 WP_000035320.1.73401 WP_000035320.1.73420 WP_000035320.1.73444 WP_000035320.1.73450 WP_000035320.1.73456 WP_000035320.1.73464 WP_000035320.1.73467 WP_000035320.1.73513 WP_000035320.1.73526 WP_000035320.1.73539 WP_000035320.1.73571 WP_000035320.1.736 WP_000035320.1.7360 WP_000035320.1.73610 WP_000035320.1.73639 WP_000035320.1.7365 WP_000035320.1.73674 WP_000035320.1.73685 WP_000035320.1.73693 WP_000035320.1.73694 WP_000035320.1.73733 WP_000035320.1.73736 WP_000035320.1.73740 WP_000035320.1.73759 WP_000035320.1.73786 WP_000035320.1.73789 WP_000035320.1.7380 WP_000035320.1.73834 WP_000035320.1.73858 WP_000035320.1.73868 WP_000035320.1.73880 WP_000035320.1.73885 WP_000035320.1.73900 WP_000035320.1.73910 WP_000035320.1.73920 WP_000035320.1.73921 WP_000035320.1.73940 WP_000035320.1.73949 WP_000035320.1.73961 WP_000035320.1.73971 WP_000035320.1.73976 WP_000035320.1.73983 WP_000035320.1.74004 WP_000035320.1.74006 WP_000035320.1.7401 WP_000035320.1.74010 WP_000035320.1.74013 WP_000035320.1.74027 WP_000035320.1.7406 WP_000035320.1.74073 WP_000035320.1.74081 WP_000035320.1.74085 WP_000035320.1.74155 WP_000035320.1.74157 WP_000035320.1.74158 WP_000035320.1.74173 WP_000035320.1.7418 WP_000035320.1.74183 WP_000035320.1.74187 WP_000035320.1.74201 WP_000035320.1.74216 WP_000035320.1.74234 WP_000035320.1.74237 WP_000035320.1.74242 WP_000035320.1.74257 WP_000035320.1.7427 WP_000035320.1.74273 WP_000035320.1.7428 WP_000035320.1.74284 WP_000035320.1.74295 WP_000035320.1.74327 WP_000035320.1.74338 WP_000035320.1.74356 WP_000035320.1.74380 WP_000035320.1.74456 WP_000035320.1.74468 WP_000035320.1.74486 WP_000035320.1.74533 WP_000035320.1.74556 WP_000035320.1.7457 WP_000035320.1.74576 WP_000035320.1.74587 WP_000035320.1.74610 WP_000035320.1.74638 WP_000035320.1.74645 WP_000035320.1.74676 WP_000035320.1.74681 WP_000035320.1.74693 WP_000035320.1.74696 WP_000035320.1.74704 WP_000035320.1.74731 WP_000035320.1.74747 WP_000035320.1.74758 WP_000035320.1.74761 WP_000035320.1.74770 WP_000035320.1.74781 WP_000035320.1.74785 WP_000035320.1.74797 WP_000035320.1.7482 WP_000035320.1.74840 WP_000035320.1.74846 WP_000035320.1.74849 WP_000035320.1.74866 WP_000035320.1.74874 WP_000035320.1.74890 WP_000035320.1.74899 WP_000035320.1.74911 WP_000035320.1.74922 WP_000035320.1.74963 WP_000035320.1.74978 WP_000035320.1.74994 WP_000035320.1.7500 WP_000035320.1.75006 WP_000035320.1.75038 WP_000035320.1.75044 WP_000035320.1.75048 WP_000035320.1.75070 WP_000035320.1.75091 WP_000035320.1.75093 WP_000035320.1.75111 WP_000035320.1.75122 WP_000035320.1.75131 WP_000035320.1.75132 WP_000035320.1.75141 WP_000035320.1.75186 WP_000035320.1.75227 WP_000035320.1.75252 WP_000035320.1.75253 WP_000035320.1.75294 WP_000035320.1.75323 WP_000035320.1.75327 WP_000035320.1.75349 WP_000035320.1.75351 WP_000035320.1.75356 WP_000035320.1.75365 WP_000035320.1.75369 WP_000035320.1.75379 WP_000035320.1.75399 WP_000035320.1.75409 WP_000035320.1.75411 WP_000035320.1.7542 WP_000035320.1.75438 WP_000035320.1.75440 WP_000035320.1.75481 WP_000035320.1.75506 WP_000035320.1.75509 WP_000035320.1.75527 WP_000035320.1.75538 WP_000035320.1.75542 WP_000035320.1.75566 WP_000035320.1.75571 WP_000035320.1.75623 WP_000035320.1.75647 WP_000035320.1.75649 WP_000035320.1.75652 WP_000035320.1.75680 WP_000035320.1.75685 WP_000035320.1.75692 WP_000035320.1.75728 WP_000035320.1.75743 WP_000035320.1.75769 WP_000035320.1.75775 WP_000035320.1.758 WP_000035320.1.75800 WP_000035320.1.75809 WP_000035320.1.75824 WP_000035320.1.75830 WP_000035320.1.7584 WP_000035320.1.75840 WP_000035320.1.75848 WP_000035320.1.75851 WP_000035320.1.75856 WP_000035320.1.75862 WP_000035320.1.75879 WP_000035320.1.75885 WP_000035320.1.75910 WP_000035320.1.75952 WP_000035320.1.75956 WP_000035320.1.7596 WP_000035320.1.75969 WP_000035320.1.76010 WP_000035320.1.76013 WP_000035320.1.7602 WP_000035320.1.76047 WP_000035320.1.76049 WP_000035320.1.76050 WP_000035320.1.76053 WP_000035320.1.76071 WP_000035320.1.76073 WP_000035320.1.76095 WP_000035320.1.76111 WP_000035320.1.76112 WP_000035320.1.76114 WP_000035320.1.76121 WP_000035320.1.76136 WP_000035320.1.76143 WP_000035320.1.76149 WP_000035320.1.76153 WP_000035320.1.76179 WP_000035320.1.76185 WP_000035320.1.76230 WP_000035320.1.7624 WP_000035320.1.76261 WP_000035320.1.7627 WP_000035320.1.76282 WP_000035320.1.76283 WP_000035320.1.76294 WP_000035320.1.76313 WP_000035320.1.76323 WP_000035320.1.76333 WP_000035320.1.76337 WP_000035320.1.7638 WP_000035320.1.76411 WP_000035320.1.76419 WP_000035320.1.76420 WP_000035320.1.76421 WP_000035320.1.76424 WP_000035320.1.76426 WP_000035320.1.76431 WP_000035320.1.76463 WP_000035320.1.76482 WP_000035320.1.76497 WP_000035320.1.765 WP_000035320.1.76528 WP_000035320.1.7658 WP_000035320.1.76604 WP_000035320.1.76606 WP_000035320.1.76624 WP_000035320.1.76674 WP_000035320.1.76686 WP_000035320.1.76690 WP_000035320.1.76693 WP_000035320.1.76711 WP_000035320.1.76718 WP_000035320.1.7675 WP_000035320.1.76792 WP_000035320.1.76798 WP_000035320.1.768 WP_000035320.1.76816 WP_000035320.1.76820 WP_000035320.1.76825 WP_000035320.1.76829 WP_000035320.1.76839 WP_000035320.1.76845 WP_000035320.1.7686 WP_000035320.1.76867 WP_000035320.1.76878 WP_000035320.1.76897 WP_000035320.1.76921 WP_000035320.1.7694 WP_000035320.1.76944 WP_000035320.1.76952 WP_000035320.1.76998 WP_000035320.1.77013 WP_000035320.1.77020 WP_000035320.1.77027 WP_000035320.1.77031 WP_000035320.1.77043 WP_000035320.1.77050 WP_000035320.1.77060 WP_000035320.1.77062 WP_000035320.1.77072 WP_000035320.1.77112 WP_000035320.1.77137 WP_000035320.1.77145 WP_000035320.1.77158 WP_000035320.1.77187 WP_000035320.1.77190 WP_000035320.1.77203 WP_000035320.1.77229 WP_000035320.1.77256 WP_000035320.1.77259 WP_000035320.1.77297 WP_000035320.1.77298 WP_000035320.1.77305 WP_000035320.1.77331 WP_000035320.1.77346 WP_000035320.1.77354 WP_000035320.1.77359 WP_000035320.1.77388 WP_000035320.1.77446 WP_000035320.1.7745 WP_000035320.1.7746 WP_000035320.1.77460 WP_000035320.1.77485 WP_000035320.1.77489 WP_000035320.1.77497 WP_000035320.1.77498 WP_000035320.1.7752 WP_000035320.1.77520 WP_000035320.1.77527 WP_000035320.1.77532 WP_000035320.1.77536 WP_000035320.1.77603 WP_000035320.1.77650 WP_000035320.1.77674 WP_000035320.1.77733 WP_000035320.1.77735 WP_000035320.1.7774 WP_000035320.1.77743 WP_000035320.1.77745 WP_000035320.1.77763 WP_000035320.1.77791 WP_000035320.1.77805 WP_000035320.1.77818 WP_000035320.1.77822 WP_000035320.1.77827 WP_000035320.1.77832 WP_000035320.1.77848 WP_000035320.1.7785 WP_000035320.1.77858 WP_000035320.1.7786 WP_000035320.1.7787 WP_000035320.1.77882 WP_000035320.1.77893 WP_000035320.1.77896 WP_000035320.1.77908 WP_000035320.1.77915 WP_000035320.1.77922 WP_000035320.1.77930 WP_000035320.1.77957 WP_000035320.1.77986 WP_000035320.1.78002 WP_000035320.1.78038 WP_000035320.1.78050 WP_000035320.1.78054 WP_000035320.1.78082 WP_000035320.1.78091 WP_000035320.1.78093 WP_000035320.1.78095 WP_000035320.1.7810 WP_000035320.1.78126 WP_000035320.1.78164 WP_000035320.1.78173 WP_000035320.1.78179 WP_000035320.1.78185 WP_000035320.1.78189 WP_000035320.1.78194 WP_000035320.1.78207 WP_000035320.1.78208 WP_000035320.1.78252 WP_000035320.1.78257 WP_000035320.1.7827 WP_000035320.1.78304 WP_000035320.1.78311 WP_000035320.1.7833 WP_000035320.1.78330 WP_000035320.1.78332 WP_000035320.1.78335 WP_000035320.1.78365 WP_000035320.1.78371 WP_000035320.1.78392 WP_000035320.1.78404 WP_000035320.1.78434 WP_000035320.1.78436 WP_000035320.1.78458 WP_000035320.1.78470 WP_000035320.1.78489 WP_000035320.1.78494 WP_000035320.1.7850 WP_000035320.1.78513 WP_000035320.1.7853 WP_000035320.1.78550 WP_000035320.1.78558 WP_000035320.1.7857 WP_000035320.1.78573 WP_000035320.1.78582 WP_000035320.1.78585 WP_000035320.1.78592 WP_000035320.1.78596 WP_000035320.1.78598 WP_000035320.1.78604 WP_000035320.1.78625 WP_000035320.1.78633 WP_000035320.1.78653 WP_000035320.1.78662 WP_000035320.1.78667 WP_000035320.1.7868 WP_000035320.1.78685 WP_000035320.1.78708 WP_000035320.1.78728 WP_000035320.1.78731 WP_000035320.1.78736 WP_000035320.1.78758 WP_000035320.1.78763 WP_000035320.1.78785 WP_000035320.1.78803 WP_000035320.1.78816 WP_000035320.1.78819 WP_000035320.1.78872 WP_000035320.1.7888 WP_000035320.1.78920 WP_000035320.1.78934 WP_000035320.1.78937 WP_000035320.1.78946 WP_000035320.1.78983 WP_000035320.1.78985 WP_000035320.1.78991 WP_000035320.1.78995 WP_000035320.1.79006 WP_000035320.1.79037 WP_000035320.1.79038 WP_000035320.1.7905 WP_000035320.1.79051 WP_000035320.1.79110 WP_000035320.1.79114 WP_000035320.1.79131 WP_000035320.1.7914 WP_000035320.1.79143 WP_000035320.1.79170 WP_000035320.1.79178 WP_000035320.1.79192 WP_000035320.1.79197 WP_000035320.1.79223 WP_000035320.1.79227 WP_000035320.1.79244 WP_000035320.1.79270 WP_000035320.1.79275 WP_000035320.1.79285 WP_000035320.1.7931 WP_000035320.1.79314 WP_000035320.1.79320 WP_000035320.1.79322 WP_000035320.1.79332 WP_000035320.1.79334 WP_000035320.1.7934 WP_000035320.1.79341 WP_000035320.1.79367 WP_000035320.1.79374 WP_000035320.1.79378 WP_000035320.1.79379 WP_000035320.1.79402 WP_000035320.1.79436 WP_000035320.1.79461 WP_000035320.1.79473 WP_000035320.1.79476 WP_000035320.1.79539 WP_000035320.1.79543 WP_000035320.1.79552 WP_000035320.1.79556 WP_000035320.1.79581 WP_000035320.1.79626 WP_000035320.1.79627 WP_000035320.1.79638 WP_000035320.1.79646 WP_000035320.1.79662 WP_000035320.1.79664 WP_000035320.1.79672 WP_000035320.1.79676 WP_000035320.1.79677 WP_000035320.1.79706 WP_000035320.1.79731 WP_000035320.1.79763 WP_000035320.1.7981 WP_000035320.1.79810 WP_000035320.1.79815 WP_000035320.1.79834 WP_000035320.1.79837 WP_000035320.1.79855 WP_000035320.1.7989 WP_000035320.1.79896 WP_000035320.1.79904 WP_000035320.1.79919 WP_000035320.1.7992 WP_000035320.1.79941 WP_000035320.1.79949 WP_000035320.1.79961 WP_000035320.1.79971 WP_000035320.1.79991 WP_000035320.1.80000 WP_000035320.1.80009 WP_000035320.1.80013 WP_000035320.1.80029 WP_000035320.1.80032 WP_000035320.1.80034 WP_000035320.1.80042 WP_000035320.1.80079 WP_000035320.1.80086 WP_000035320.1.80119 WP_000035320.1.80120 WP_000035320.1.80122 WP_000035320.1.80127 WP_000035320.1.80146 WP_000035320.1.80147 WP_000035320.1.80159 WP_000035320.1.80178 WP_000035320.1.80184 WP_000035320.1.80203 WP_000035320.1.80206 WP_000035320.1.80210 WP_000035320.1.80244 WP_000035320.1.80274 WP_000035320.1.80287 WP_000035320.1.80290 WP_000035320.1.80297 WP_000035320.1.80303 WP_000035320.1.8031 WP_000035320.1.80316 WP_000035320.1.80318 WP_000035320.1.8035 WP_000035320.1.80361 WP_000035320.1.80378 WP_000035320.1.80389 WP_000035320.1.8040 WP_000035320.1.80414 WP_000035320.1.8043 WP_000035320.1.80434 WP_000035320.1.8045 WP_000035320.1.80472 WP_000035320.1.80482 WP_000035320.1.80521 WP_000035320.1.80530 WP_000035320.1.80582 WP_000035320.1.8065 WP_000035320.1.8066 WP_000035320.1.80687 WP_000035320.1.80717 WP_000035320.1.80734 WP_000035320.1.80745 WP_000035320.1.80763 WP_000035320.1.80781 WP_000035320.1.80786 WP_000035320.1.80793 WP_000035320.1.80801 WP_000035320.1.80828 WP_000035320.1.80833 WP_000035320.1.8085 WP_000035320.1.80855 WP_000035320.1.80872 WP_000035320.1.80899 WP_000035320.1.80979 WP_000035320.1.80980 WP_000035320.1.81010 WP_000035320.1.81022 WP_000035320.1.81049 WP_000035320.1.81052 WP_000035320.1.81064 WP_000035320.1.81065 WP_000035320.1.81085 WP_000035320.1.81092 WP_000035320.1.81095 WP_000035320.1.81097 WP_000035320.1.81114 WP_000035320.1.81132 WP_000035320.1.81151 WP_000035320.1.81157 WP_000035320.1.81171 WP_000035320.1.81172 WP_000035320.1.81184 WP_000035320.1.81214 WP_000035320.1.81228 WP_000035320.1.81232 WP_000035320.1.81234 WP_000035320.1.8125 WP_000035320.1.81252 WP_000035320.1.81288 WP_000035320.1.81290 WP_000035320.1.81344 WP_000035320.1.81379 WP_000035320.1.81384 WP_000035320.1.81385 WP_000035320.1.81389 WP_000035320.1.81436 WP_000035320.1.8144 WP_000035320.1.81464 WP_000035320.1.81467 WP_000035320.1.81508 WP_000035320.1.81549 WP_000035320.1.81572 WP_000035320.1.81574 WP_000035320.1.81599 WP_000035320.1.8160 WP_000035320.1.81604 WP_000035320.1.81610 WP_000035320.1.81619 WP_000035320.1.81631 WP_000035320.1.81637 WP_000035320.1.81645 WP_000035320.1.81718 WP_000035320.1.81734 WP_000035320.1.81758 WP_000035320.1.8176 WP_000035320.1.81767 WP_000035320.1.8180 WP_000035320.1.81800 WP_000035320.1.81810 WP_000035320.1.81831 WP_000035320.1.81837 WP_000035320.1.81838 WP_000035320.1.8185 WP_000035320.1.81861 WP_000035320.1.8188 WP_000035320.1.81904 WP_000035320.1.81905 WP_000035320.1.81906 WP_000035320.1.81940 WP_000035320.1.81944 WP_000035320.1.81955 WP_000035320.1.81969 WP_000035320.1.81990 WP_000035320.1.81996 WP_000035320.1.81999 WP_000035320.1.82015 WP_000035320.1.82053 WP_000035320.1.8206 WP_000035320.1.82103 WP_000035320.1.8212 WP_000035320.1.82121 WP_000035320.1.8213 WP_000035320.1.82161 WP_000035320.1.82167 WP_000035320.1.82174 WP_000035320.1.82184 WP_000035320.1.82219 WP_000035320.1.82247 WP_000035320.1.82253 WP_000035320.1.82259 WP_000035320.1.82281 WP_000035320.1.82301 WP_000035320.1.82340 WP_000035320.1.82349 WP_000035320.1.82354 WP_000035320.1.82368 WP_000035320.1.82406 WP_000035320.1.8244 WP_000035320.1.82441 WP_000035320.1.82458 WP_000035320.1.8246 WP_000035320.1.82467 WP_000035320.1.82468 WP_000035320.1.82525 WP_000035320.1.82535 WP_000035320.1.82548 WP_000035320.1.82558 WP_000035320.1.82612 WP_000035320.1.8265 WP_000035320.1.8266 WP_000035320.1.82678 WP_000035320.1.82709 WP_000035320.1.82724 WP_000035320.1.82760 WP_000035320.1.82762 WP_000035320.1.82768 WP_000035320.1.82775 WP_000035320.1.82796 WP_000035320.1.8280 WP_000035320.1.82802 WP_000035320.1.82824 WP_000035320.1.82829 WP_000035320.1.82835 WP_000035320.1.82855 WP_000035320.1.82862 WP_000035320.1.8289 WP_000035320.1.82916 WP_000035320.1.82930 WP_000035320.1.82931 WP_000035320.1.82941 WP_000035320.1.82980 WP_000035320.1.82984 WP_000035320.1.82997 WP_000035320.1.83011 WP_000035320.1.83013 WP_000035320.1.83046 WP_000035320.1.83050 WP_000035320.1.83053 WP_000035320.1.83054 WP_000035320.1.83066 WP_000035320.1.83078 WP_000035320.1.83086 WP_000035320.1.8310 WP_000035320.1.83103 WP_000035320.1.83152 WP_000035320.1.83153 WP_000035320.1.8318 WP_000035320.1.83185 WP_000035320.1.83193 WP_000035320.1.83203 WP_000035320.1.83234 WP_000035320.1.83243 WP_000035320.1.8328 WP_000035320.1.83291 WP_000035320.1.83316 WP_000035320.1.83352 WP_000035320.1.83359 WP_000035320.1.83372 WP_000035320.1.83405 WP_000035320.1.83416 WP_000035320.1.83417 WP_000035320.1.83418 WP_000035320.1.8346 WP_000035320.1.83467 WP_000035320.1.83468 WP_000035320.1.83472 WP_000035320.1.83475 WP_000035320.1.83476 WP_000035320.1.83479 WP_000035320.1.83484 WP_000035320.1.83508 WP_000035320.1.83517 WP_000035320.1.83520 WP_000035320.1.83553 WP_000035320.1.83592 WP_000035320.1.83593 WP_000035320.1.83624 WP_000035320.1.83626 WP_000035320.1.83645 WP_000035320.1.83646 WP_000035320.1.83652 WP_000035320.1.83653 WP_000035320.1.8366 WP_000035320.1.83674 WP_000035320.1.83676 WP_000035320.1.83714 WP_000035320.1.83720 WP_000035320.1.83728 WP_000035320.1.83750 WP_000035320.1.83756 WP_000035320.1.83758 WP_000035320.1.83763 WP_000035320.1.83769 WP_000035320.1.83770 WP_000035320.1.83775 WP_000035320.1.83778 WP_000035320.1.83788 WP_000035320.1.83797 WP_000035320.1.83804 WP_000035320.1.83825 WP_000035320.1.8383 WP_000035320.1.83837 WP_000035320.1.83844 WP_000035320.1.8385 WP_000035320.1.83852 WP_000035320.1.83864 WP_000035320.1.83865 WP_000035320.1.83868 WP_000035320.1.83881 WP_000035320.1.83886 WP_000035320.1.83902 WP_000035320.1.83905 WP_000035320.1.83912 WP_000035320.1.83919 WP_000035320.1.83925 WP_000035320.1.83928 WP_000035320.1.83935 WP_000035320.1.83955 WP_000035320.1.83984 WP_000035320.1.83989 WP_000035320.1.84010 WP_000035320.1.84025 WP_000035320.1.84041 WP_000035320.1.84049 WP_000035320.1.84054 WP_000035320.1.84064 WP_000035320.1.84067 WP_000035320.1.84068 WP_000035320.1.84118 WP_000035320.1.84129 WP_000035320.1.84144 WP_000035320.1.84161 WP_000035320.1.84188 WP_000035320.1.84275 WP_000035320.1.84284 WP_000035320.1.84293 WP_000035320.1.84322 WP_000035320.1.84342 WP_000035320.1.84414 WP_000035320.1.84415 WP_000035320.1.84416 WP_000035320.1.84418 WP_000035320.1.84442 WP_000035320.1.84451 WP_000035320.1.84508 WP_000035320.1.84509 WP_000035320.1.84555 WP_000035320.1.84570 WP_000035320.1.84578 WP_000035320.1.84590 WP_000035320.1.84596 WP_000035320.1.84608 WP_000035320.1.84612 WP_000035320.1.8462 WP_000035320.1.84625 WP_000035320.1.84630 WP_000035320.1.84638 WP_000035320.1.84648 WP_000035320.1.84651 WP_000035320.1.84652 WP_000035320.1.84662 WP_000035320.1.8468 WP_000035320.1.84682 WP_000035320.1.84696 WP_000035320.1.84757 WP_000035320.1.84761 WP_000035320.1.84815 WP_000035320.1.84826 WP_000035320.1.84844 WP_000035320.1.84847 WP_000035320.1.84854 WP_000035320.1.84889 WP_000035320.1.84903 WP_000035320.1.84922 WP_000035320.1.84924 WP_000035320.1.8493 WP_000035320.1.84943 WP_000035320.1.8496 WP_000035320.1.84975 WP_000035320.1.84978 WP_000035320.1.85017 WP_000035320.1.85022 WP_000035320.1.85026 WP_000035320.1.85045 WP_000035320.1.85047 WP_000035320.1.85070 WP_000035320.1.85081 WP_000035320.1.85083 WP_000035320.1.85099 WP_000035320.1.851 WP_000035320.1.85118 WP_000035320.1.85132 WP_000035320.1.85151 WP_000035320.1.85160 WP_000035320.1.85213 WP_000035320.1.85224 WP_000035320.1.85226 WP_000035320.1.85229 WP_000035320.1.85231 WP_000035320.1.85235 WP_000035320.1.85238 WP_000035320.1.85289 WP_000035320.1.85292 WP_000035320.1.85294 WP_000035320.1.85297 WP_000035320.1.85302 WP_000035320.1.85351 WP_000035320.1.85375 WP_000035320.1.85376 WP_000035320.1.85383 WP_000035320.1.85395 WP_000035320.1.85404 WP_000035320.1.85409 WP_000035320.1.85440 WP_000035320.1.85441 WP_000035320.1.85455 WP_000035320.1.85462 WP_000035320.1.85471 WP_000035320.1.85474 WP_000035320.1.85485 WP_000035320.1.85492 WP_000035320.1.85506 WP_000035320.1.8551 WP_000035320.1.85515 WP_000035320.1.85519 WP_000035320.1.85542 WP_000035320.1.85547 WP_000035320.1.85555 WP_000035320.1.85585 WP_000035320.1.85586 WP_000035320.1.85596 WP_000035320.1.85607 WP_000035320.1.85611 WP_000035320.1.85649 WP_000035320.1.85678 WP_000035320.1.85705 WP_000035320.1.8572 WP_000035320.1.85730 WP_000035320.1.85732 WP_000035320.1.85758 WP_000035320.1.8576 WP_000035320.1.85795 WP_000035320.1.85796 WP_000035320.1.85809 WP_000035320.1.85816 WP_000035320.1.85834 WP_000035320.1.85844 WP_000035320.1.85858 WP_000035320.1.85873 WP_000035320.1.85906 WP_000035320.1.85924 WP_000035320.1.85950 WP_000035320.1.85980 WP_000035320.1.85989 WP_000035320.1.85993 WP_000035320.1.86018 WP_000035320.1.86036 WP_000035320.1.86042 WP_000035320.1.86072 WP_000035320.1.86086 WP_000035320.1.8609 WP_000035320.1.86101 WP_000035320.1.86106 WP_000035320.1.86123 WP_000035320.1.86144 WP_000035320.1.86154 WP_000035320.1.86158 WP_000035320.1.8617 WP_000035320.1.86178 WP_000035320.1.86188 WP_000035320.1.862 WP_000035320.1.86207 WP_000035320.1.86248 WP_000035320.1.86256 WP_000035320.1.8627 WP_000035320.1.86270 WP_000035320.1.86281 WP_000035320.1.86304 WP_000035320.1.86315 WP_000035320.1.86344 WP_000035320.1.8636 WP_000035320.1.86363 WP_000035320.1.86390 WP_000035320.1.8643 WP_000035320.1.86439 WP_000035320.1.86473 WP_000035320.1.86505 WP_000035320.1.86523 WP_000035320.1.86526 WP_000035320.1.86531 WP_000035320.1.86542 WP_000035320.1.86606 WP_000035320.1.86628 WP_000035320.1.86629 WP_000035320.1.86664 WP_000035320.1.86704 WP_000035320.1.86706 WP_000035320.1.86736 WP_000035320.1.86745 WP_000035320.1.86754 WP_000035320.1.86779 WP_000035320.1.86793 WP_000035320.1.86795 WP_000035320.1.8681 WP_000035320.1.86838 WP_000035320.1.86881 WP_000035320.1.8690 WP_000035320.1.86910 WP_000035320.1.86911 WP_000035320.1.86940 WP_000035320.1.86942 WP_000035320.1.86955 WP_000035320.1.86961 WP_000035320.1.86968 WP_000035320.1.86977 WP_000035320.1.86999 WP_000035320.1.87022 WP_000035320.1.87042 WP_000035320.1.87072 WP_000035320.1.87088 WP_000035320.1.87090 WP_000035320.1.87097 WP_000035320.1.87100 WP_000035320.1.8712 WP_000035320.1.87133 WP_000035320.1.87137 WP_000035320.1.87141 WP_000035320.1.87168 WP_000035320.1.87175 WP_000035320.1.87190 WP_000035320.1.87194 WP_000035320.1.8720 WP_000035320.1.87204 WP_000035320.1.87221 WP_000035320.1.87250 WP_000035320.1.87260 WP_000035320.1.87261 WP_000035320.1.87263 WP_000035320.1.87264 WP_000035320.1.87272 WP_000035320.1.87285 WP_000035320.1.87290 WP_000035320.1.87296 WP_000035320.1.8731 WP_000035320.1.87363 WP_000035320.1.87372 WP_000035320.1.87378 WP_000035320.1.87388 WP_000035320.1.87391 WP_000035320.1.87396 WP_000035320.1.87397 WP_000035320.1.87425 WP_000035320.1.87434 WP_000035320.1.87457 WP_000035320.1.87461 WP_000035320.1.87466 WP_000035320.1.87475 WP_000035320.1.87486 WP_000035320.1.87498 WP_000035320.1.875 WP_000035320.1.87502 WP_000035320.1.87508 WP_000035320.1.87511 WP_000035320.1.87515 WP_000035320.1.8753 WP_000035320.1.87543 WP_000035320.1.87595 WP_000035320.1.87601 WP_000035320.1.87623 WP_000035320.1.8764 WP_000035320.1.87718 WP_000035320.1.87734 WP_000035320.1.87740 WP_000035320.1.87745 WP_000035320.1.87748 WP_000035320.1.87764 WP_000035320.1.87782 WP_000035320.1.8779 WP_000035320.1.87802 WP_000035320.1.87808 WP_000035320.1.87828 WP_000035320.1.87838 WP_000035320.1.87841 WP_000035320.1.87854 WP_000035320.1.87865 WP_000035320.1.87879 WP_000035320.1.8791 WP_000035320.1.87912 WP_000035320.1.87937 WP_000035320.1.87943 WP_000035320.1.87948 WP_000035320.1.87963 WP_000035320.1.87964 WP_000035320.1.87967 WP_000035320.1.87972 WP_000035320.1.87995 WP_000035320.1.88013 WP_000035320.1.88032 WP_000035320.1.88061 WP_000035320.1.88114 WP_000035320.1.88150 WP_000035320.1.88166 WP_000035320.1.88169 WP_000035320.1.8820 WP_000035320.1.88279 WP_000035320.1.88309 WP_000035320.1.88311 WP_000035320.1.88317 WP_000035320.1.88328 WP_000035320.1.88348 WP_000035320.1.88351 WP_000035320.1.88367 WP_000035320.1.88371 WP_000035320.1.88373 WP_000035320.1.88375 WP_000035320.1.88380 WP_000035320.1.88395 WP_000035320.1.88418 WP_000035320.1.88430 WP_000035320.1.88449 WP_000035320.1.8847 WP_000035320.1.88471 WP_000035320.1.88473 WP_000035320.1.88480 WP_000035320.1.88498 WP_000035320.1.88518 WP_000035320.1.88555 WP_000035320.1.88558 WP_000035320.1.88560 WP_000035320.1.88563 WP_000035320.1.88580 WP_000035320.1.88583 WP_000035320.1.88585 WP_000035320.1.8859 WP_000035320.1.88599 WP_000035320.1.88614 WP_000035320.1.88623 WP_000035320.1.88642 WP_000035320.1.88671 WP_000035320.1.88694 WP_000035320.1.88696 WP_000035320.1.8872 WP_000035320.1.88739 WP_000035320.1.88753 WP_000035320.1.88761 WP_000035320.1.88771 WP_000035320.1.88781 WP_000035320.1.88827 WP_000035320.1.88843 WP_000035320.1.88856 WP_000035320.1.88859 WP_000035320.1.8886 WP_000035320.1.88861 WP_000035320.1.88871 WP_000035320.1.88874 WP_000035320.1.88878 WP_000035320.1.8888 WP_000035320.1.88897 WP_000035320.1.88912 WP_000035320.1.88922 WP_000035320.1.88954 WP_000035320.1.88960 WP_000035320.1.88962 WP_000035320.1.88987 WP_000035320.1.8899 WP_000035320.1.8900 WP_000035320.1.89012 WP_000035320.1.89024 WP_000035320.1.89036 WP_000035320.1.89070 WP_000035320.1.89086 WP_000035320.1.89103 WP_000035320.1.89125 WP_000035320.1.89133 WP_000035320.1.89164 WP_000035320.1.89173 WP_000035320.1.8918 WP_000035320.1.89181 WP_000035320.1.89184 WP_000035320.1.89194 WP_000035320.1.89204 WP_000035320.1.89229 WP_000035320.1.89235 WP_000035320.1.89237 WP_000035320.1.8924 WP_000035320.1.89258 WP_000035320.1.89262 WP_000035320.1.89284 WP_000035320.1.89290 WP_000035320.1.89347 WP_000035320.1.89348 WP_000035320.1.89350 WP_000035320.1.89390 WP_000035320.1.89404 WP_000035320.1.89414 WP_000035320.1.89433 WP_000035320.1.89516 WP_000035320.1.8953 WP_000035320.1.89537 WP_000035320.1.89544 WP_000035320.1.89545 WP_000035320.1.89559 WP_000035320.1.89628 WP_000035320.1.89651 WP_000035320.1.89655 WP_000035320.1.89672 WP_000035320.1.89678 WP_000035320.1.897 WP_000035320.1.89715 WP_000035320.1.89726 WP_000035320.1.89730 WP_000035320.1.89754 WP_000035320.1.89779 WP_000035320.1.89794 WP_000035320.1.898 WP_000035320.1.89857 WP_000035320.1.8986 WP_000035320.1.89860 WP_000035320.1.89863 WP_000035320.1.89883 WP_000035320.1.89908 WP_000035320.1.89933 WP_000035320.1.89935 WP_000035320.1.89949 WP_000035320.1.89950 WP_000035320.1.89960 WP_000035320.1.90005 WP_000035320.1.90038 WP_000035320.1.90046 WP_000035320.1.90055 WP_000035320.1.90069 WP_000035320.1.90091 WP_000035320.1.90112 WP_000035320.1.90131 WP_000035320.1.90173 WP_000035320.1.90174 WP_000035320.1.90217 WP_000035320.1.9022 WP_000035320.1.90232 WP_000035320.1.90243 WP_000035320.1.90244 WP_000035320.1.90246 WP_000035320.1.90250 WP_000035320.1.90253 WP_000035320.1.90276 WP_000035320.1.9030 WP_000035320.1.90307 WP_000035320.1.90331 WP_000035320.1.90367 WP_000035320.1.90386 WP_000035320.1.90432 WP_000035320.1.90447 WP_000035320.1.90454 WP_000035320.1.90473 WP_000035320.1.90475 WP_000035320.1.90488 WP_000035320.1.90506 WP_000035320.1.90517 WP_000035320.1.90533 WP_000035320.1.90544 WP_000035320.1.90548 WP_000035320.1.9055 WP_000035320.1.90554 WP_000035320.1.90556 WP_000035320.1.90562 WP_000035320.1.90604 WP_000035320.1.90647 WP_000035320.1.90660 WP_000035320.1.90698 WP_000035320.1.90717 WP_000035320.1.90726 WP_000035320.1.90728 WP_000035320.1.90738 WP_000035320.1.9074 WP_000035320.1.90745 WP_000035320.1.9076 WP_000035320.1.90777 WP_000035320.1.90801 WP_000035320.1.90804 WP_000035320.1.90875 WP_000035320.1.90887 WP_000035320.1.90896 WP_000035320.1.90903 WP_000035320.1.90923 WP_000035320.1.90928 WP_000035320.1.91005 WP_000035320.1.91011 WP_000035320.1.91019 WP_000035320.1.91054 WP_000035320.1.91087 WP_000035320.1.91089 WP_000035320.1.91124 WP_000035320.1.91126 WP_000035320.1.9114 WP_000035320.1.91150 WP_000035320.1.91177 WP_000035320.1.912 WP_000035320.1.9122 WP_000035320.1.91233 WP_000035320.1.91246 WP_000035320.1.91252 WP_000035320.1.91258 WP_000035320.1.9127 WP_000035320.1.91279 WP_000035320.1.91280 WP_000035320.1.91287 WP_000035320.1.9130 WP_000035320.1.91300 WP_000035320.1.91310 WP_000035320.1.91316 WP_000035320.1.91332 WP_000035320.1.91357 WP_000035320.1.91364 WP_000035320.1.91365 WP_000035320.1.91371 WP_000035320.1.91380 WP_000035320.1.91382 WP_000035320.1.9140 WP_000035320.1.91420 WP_000035320.1.91427 WP_000035320.1.91447 WP_000035320.1.91465 WP_000035320.1.91486 WP_000035320.1.91487 WP_000035320.1.91500 WP_000035320.1.91501 WP_000035320.1.91525 WP_000035320.1.91530 WP_000035320.1.91542 WP_000035320.1.91547 WP_000035320.1.9155 WP_000035320.1.91573 WP_000035320.1.91581 WP_000035320.1.91586 WP_000035320.1.91591 WP_000035320.1.91611 WP_000035320.1.91634 WP_000035320.1.91635 WP_000035320.1.91639 WP_000035320.1.91670 WP_000035320.1.917 WP_000035320.1.91704 WP_000035320.1.91745 WP_000035320.1.91749 WP_000035320.1.91781 WP_000035320.1.91791 WP_000035320.1.91800 WP_000035320.1.91816 WP_000035320.1.91829 WP_000035320.1.91848 WP_000035320.1.91895 WP_000035320.1.91911 WP_000035320.1.91918 WP_000035320.1.91928 WP_000035320.1.91955 WP_000035320.1.91969 WP_000035320.1.92 WP_000035320.1.92055 WP_000035320.1.92057 WP_000035320.1.92104 WP_000035320.1.92110 WP_000035320.1.92115 WP_000035320.1.92125 WP_000035320.1.92133 WP_000035320.1.92140 WP_000035320.1.92158 WP_000035320.1.92164 WP_000035320.1.92169 WP_000035320.1.92173 WP_000035320.1.92185 WP_000035320.1.92186 WP_000035320.1.92212 WP_000035320.1.92218 WP_000035320.1.92227 WP_000035320.1.92228 WP_000035320.1.9224 WP_000035320.1.92244 WP_000035320.1.92249 WP_000035320.1.92253 WP_000035320.1.92254 WP_000035320.1.92278 WP_000035320.1.92297 WP_000035320.1.923 WP_000035320.1.92303 WP_000035320.1.92324 WP_000035320.1.9234 WP_000035320.1.92340 WP_000035320.1.9239 WP_000035320.1.92391 WP_000035320.1.92398 WP_000035320.1.92405 WP_000035320.1.92424 WP_000035320.1.92425 WP_000035320.1.92436 WP_000035320.1.9247 WP_000035320.1.92479 WP_000035320.1.92500 WP_000035320.1.92512 WP_000035320.1.92520 WP_000035320.1.92534 WP_000035320.1.92541 WP_000035320.1.92565 WP_000035320.1.92602 WP_000035320.1.92607 WP_000035320.1.92667 WP_000035320.1.92674 WP_000035320.1.92679 WP_000035320.1.92691 WP_000035320.1.92718 WP_000035320.1.92726 WP_000035320.1.92735 WP_000035320.1.92741 WP_000035320.1.92765 WP_000035320.1.92772 WP_000035320.1.92773 WP_000035320.1.92795 WP_000035320.1.92805 WP_000035320.1.92840 WP_000035320.1.92848 WP_000035320.1.9286 WP_000035320.1.92862 WP_000035320.1.92864 WP_000035320.1.92918 WP_000035320.1.92937 WP_000035320.1.92950 WP_000035320.1.9296 WP_000035320.1.92960 WP_000035320.1.92965 WP_000035320.1.92997 WP_000035320.1.93047 WP_000035320.1.9305 WP_000035320.1.93071 WP_000035320.1.93074 WP_000035320.1.93078 WP_000035320.1.93125 WP_000035320.1.93141 WP_000035320.1.93147 WP_000035320.1.93176 WP_000035320.1.93191 WP_000035320.1.93197 WP_000035320.1.93207 WP_000035320.1.93224 WP_000035320.1.93231 WP_000035320.1.93235 WP_000035320.1.93237 WP_000035320.1.93243 WP_000035320.1.93251 WP_000035320.1.93254 WP_000035320.1.93260 WP_000035320.1.93272 WP_000035320.1.93296 WP_000035320.1.93300 WP_000035320.1.93329 WP_000035320.1.93336 WP_000035320.1.93378 WP_000035320.1.93416 WP_000035320.1.9346 WP_000035320.1.93514 WP_000035320.1.9352 WP_000035320.1.9354 WP_000035320.1.93561 WP_000035320.1.93567 WP_000035320.1.93579 WP_000035320.1.93590 WP_000035320.1.93613 WP_000035320.1.93678 WP_000035320.1.93708 WP_000035320.1.93722 WP_000035320.1.93736 WP_000035320.1.93758 WP_000035320.1.93762 WP_000035320.1.93769 WP_000035320.1.93775 WP_000035320.1.93787 WP_000035320.1.93862 WP_000035320.1.9387 WP_000035320.1.93883 WP_000035320.1.93890 WP_000035320.1.93934 WP_000035320.1.93972 WP_000035320.1.93976 WP_000035320.1.9398 WP_000035320.1.93981 WP_000035320.1.94 WP_000035320.1.94009 WP_000035320.1.94053 WP_000035320.1.94060 WP_000035320.1.9408 WP_000035320.1.94080 WP_000035320.1.94096 WP_000035320.1.9411 WP_000035320.1.94114 WP_000035320.1.94119 WP_000035320.1.94122 WP_000035320.1.94123 WP_000035320.1.94130 WP_000035320.1.94172 WP_000035320.1.94242 WP_000035320.1.94245 WP_000035320.1.94248 WP_000035320.1.94268 WP_000035320.1.94287 WP_000035320.1.94293 WP_000035320.1.9430 WP_000035320.1.94320 WP_000035320.1.94324 WP_000035320.1.94337 WP_000035320.1.94340 WP_000035320.1.94345 WP_000035320.1.9435 WP_000035320.1.9437 WP_000035320.1.94374 WP_000035320.1.94375 WP_000035320.1.94376 WP_000035320.1.94389 WP_000035320.1.94409 WP_000035320.1.94414 WP_000035320.1.94423 WP_000035320.1.94484 WP_000035320.1.94505 WP_000035320.1.94530 WP_000035320.1.94536 WP_000035320.1.94549 WP_000035320.1.9455 WP_000035320.1.94550 WP_000035320.1.94576 WP_000035320.1.94636 WP_000035320.1.9464 WP_000035320.1.94641 WP_000035320.1.94688 WP_000035320.1.947 WP_000035320.1.94733 WP_000035320.1.94741 WP_000035320.1.94789 WP_000035320.1.94797 WP_000035320.1.94825 WP_000035320.1.94845 WP_000035320.1.9485 WP_000035320.1.94857 WP_000035320.1.94866 WP_000035320.1.94941 WP_000035320.1.9495 WP_000035320.1.94958 WP_000035320.1.94969 WP_000035320.1.9497 WP_000035320.1.94980 WP_000035320.1.94989 WP_000035320.1.94999 WP_000035320.1.95008 WP_000035320.1.95014 WP_000035320.1.95023 WP_000035320.1.95029 WP_000035320.1.95033 WP_000035320.1.95038 WP_000035320.1.95049 WP_000035320.1.95075 WP_000035320.1.95077 WP_000035320.1.95090 WP_000035320.1.95156 WP_000035320.1.95174 WP_000035320.1.95193 WP_000035320.1.95210 WP_000035320.1.95263 WP_000035320.1.95281 WP_000035320.1.95294 WP_000035320.1.95304 WP_000035320.1.95327 WP_000035320.1.9538 WP_000035320.1.95386 WP_000035320.1.95409 WP_000035320.1.95415 WP_000035320.1.9544 WP_000035320.1.95452 WP_000035320.1.95476 WP_000035320.1.95494 WP_000035320.1.95500 WP_000035320.1.95512 WP_000035320.1.95519 WP_000035320.1.95522 WP_000035320.1.95537 WP_000035320.1.95545 WP_000035320.1.95550 WP_000035320.1.95560 WP_000035320.1.95571 WP_000035320.1.95603 WP_000035320.1.9563 WP_000035320.1.95639 WP_000035320.1.95683 WP_000035320.1.95699 WP_000035320.1.95704 WP_000035320.1.95713 WP_000035320.1.95714 WP_000035320.1.95760 WP_000035320.1.95780 WP_000035320.1.95781 WP_000035320.1.95804 WP_000035320.1.95806 WP_000035320.1.95832 WP_000035320.1.95877 WP_000035320.1.959 WP_000035320.1.95914 WP_000035320.1.95947 WP_000035320.1.95954 WP_000035320.1.95962 WP_000035320.1.95983 WP_000035320.1.95997 WP_000035320.1.96014 WP_000035320.1.96022 WP_000035320.1.96030 WP_000035320.1.96056 WP_000035320.1.96057 WP_000035320.1.96133 WP_000035320.1.96135 WP_000035320.1.96148 WP_000035320.1.96160 WP_000035320.1.96163 WP_000035320.1.9617 WP_000035320.1.96209 WP_000035320.1.96218 WP_000035320.1.96221 WP_000035320.1.96228 WP_000035320.1.96271 WP_000035320.1.96280 WP_000035320.1.96283 WP_000035320.1.96297 WP_000035320.1.96301 WP_000035320.1.96305 WP_000035320.1.96312 WP_000035320.1.96314 WP_000035320.1.96316 WP_000035320.1.96322 WP_000035320.1.96334 WP_000035320.1.96362 WP_000035320.1.96433 WP_000035320.1.96468 WP_000035320.1.96472 WP_000035320.1.96474 WP_000035320.1.96495 WP_000035320.1.9650 WP_000035320.1.96509 WP_000035320.1.96535 WP_000035320.1.96538 WP_000035320.1.96550 WP_000035320.1.96554 WP_000035320.1.96566 WP_000035320.1.96568 WP_000035320.1.96591 WP_000035320.1.96603 WP_000035320.1.96628 WP_000035320.1.96646 WP_000035320.1.96654 WP_000035320.1.96663 WP_000035320.1.96678 WP_000035320.1.96682 WP_000035320.1.96688 WP_000035320.1.96699 WP_000035320.1.96705 WP_000035320.1.96727 WP_000035320.1.9675 WP_000035320.1.96770 WP_000035320.1.96780 WP_000035320.1.96804 WP_000035320.1.96836 WP_000035320.1.9684 WP_000035320.1.96854 WP_000035320.1.96855 WP_000035320.1.96856 WP_000035320.1.96859 WP_000035320.1.96882 WP_000035320.1.96892 WP_000035320.1.96895 WP_000035320.1.96918 WP_000035320.1.96928 WP_000035320.1.9695 WP_000035320.1.96965 WP_000035320.1.96969 WP_000035320.1.96970 WP_000035320.1.96997 WP_000035320.1.97000 WP_000035320.1.97001 WP_000035320.1.97004 WP_000035320.1.97007 WP_000035320.1.97017 WP_000035320.1.97019 WP_000035320.1.97029 WP_000035320.1.97034 WP_000035320.1.97072 WP_000035320.1.97077 WP_000035320.1.97117 WP_000035320.1.97138 WP_000035320.1.97139 WP_000035320.1.97141 WP_000035320.1.97151 WP_000035320.1.97161 WP_000035320.1.97164 WP_000035320.1.97191 WP_000035320.1.97206 WP_000035320.1.97228 WP_000035320.1.97230 WP_000035320.1.97234 WP_000035320.1.97241 WP_000035320.1.97256 WP_000035320.1.97267 WP_000035320.1.97276 WP_000035320.1.97293 WP_000035320.1.97295 WP_000035320.1.97311 WP_000035320.1.97312 WP_000035320.1.97336 WP_000035320.1.97348 WP_000035320.1.97352 WP_000035320.1.97355 WP_000035320.1.97367 WP_000035320.1.9737 WP_000035320.1.97392 WP_000035320.1.97399 WP_000035320.1.97411 WP_000035320.1.97427 WP_000035320.1.9743 WP_000035320.1.97444 WP_000035320.1.97456 WP_000035320.1.97466 WP_000035320.1.97468 WP_000035320.1.97484 WP_000035320.1.97536 WP_000035320.1.97537 WP_000035320.1.97574 WP_000035320.1.97576 WP_000035320.1.97627 WP_000035320.1.97664 WP_000035320.1.97687 WP_000035320.1.97688 WP_000035320.1.97696 WP_000035320.1.97706 WP_000035320.1.97717 WP_000035320.1.97720 WP_000035320.1.97729 WP_000035320.1.97731 WP_000035320.1.97739 WP_000035320.1.97746 WP_000035320.1.97758 WP_000035320.1.97762 WP_000035320.1.97776 WP_000035320.1.97786 WP_000035320.1.97827 WP_000035320.1.97835 WP_000035320.1.9788 WP_000035320.1.9789 WP_000035320.1.97898 WP_000035320.1.97899 WP_000035320.1.97928 WP_000035320.1.97955 WP_000035320.1.97997 WP_000035320.1.97999 WP_000035320.1.98008 WP_000035320.1.98011 WP_000035320.1.98033 WP_000035320.1.98051 WP_000035320.1.98054 WP_000035320.1.98058 WP_000035320.1.98077 WP_000035320.1.98131 WP_000035320.1.98161 WP_000035320.1.98179 WP_000035320.1.98191 WP_000035320.1.98242 WP_000035320.1.98248 WP_000035320.1.98295 WP_000035320.1.98307 WP_000035320.1.98328 WP_000035320.1.98353 WP_000035320.1.98359 WP_000035320.1.98361 WP_000035320.1.98366 WP_000035320.1.98372 WP_000035320.1.98387 WP_000035320.1.98394 WP_000035320.1.98409 WP_000035320.1.98411 WP_000035320.1.98415 WP_000035320.1.98425 WP_000035320.1.98456 WP_000035320.1.98497 WP_000035320.1.98501 WP_000035320.1.98506 WP_000035320.1.98512 WP_000035320.1.98533 WP_000035320.1.98552 WP_000035320.1.98585 WP_000035320.1.98586 WP_000035320.1.986 WP_000035320.1.98655 WP_000035320.1.98659 WP_000035320.1.98667 WP_000035320.1.98703 WP_000035320.1.98706 WP_000035320.1.98723 WP_000035320.1.98730 WP_000035320.1.98734 WP_000035320.1.98741 WP_000035320.1.98750 WP_000035320.1.98767 WP_000035320.1.98786 WP_000035320.1.98797 WP_000035320.1.98825 WP_000035320.1.98837 WP_000035320.1.98842 WP_000035320.1.98858 WP_000035320.1.98865 WP_000035320.1.98874 WP_000035320.1.98880 WP_000035320.1.98883 WP_000035320.1.98894 WP_000035320.1.98924 WP_000035320.1.98967 WP_000035320.1.98978 WP_000035320.1.98985 WP_000035320.1.99009 WP_000035320.1.99025 WP_000035320.1.9903 WP_000035320.1.99090 WP_000035320.1.9910 WP_000035320.1.99155 WP_000035320.1.99171 WP_000035320.1.99195 WP_000035320.1.99207 WP_000035320.1.99217 WP_000035320.1.99237 WP_000035320.1.99249 WP_000035320.1.99262 WP_000035320.1.99280 WP_000035320.1.99283 WP_000035320.1.99311 WP_000035320.1.99359 WP_000035320.1.9936 WP_000035320.1.99394 WP_000035320.1.99405 WP_000035320.1.99414 WP_000035320.1.99418 WP_000035320.1.99430 WP_000035320.1.99459 WP_000035320.1.99492 WP_000035320.1.99494 WP_000035320.1.99509 WP_000035320.1.99519 WP_000035320.1.99523 WP_000035320.1.99525 WP_000035320.1.99536 WP_000035320.1.99538 WP_000035320.1.99564 WP_000035320.1.99569 WP_000035320.1.9960 WP_000035320.1.99631 WP_000035320.1.99638 WP_000035320.1.9965 WP_000035320.1.99683 WP_000035320.1.99686 WP_000035320.1.99688 WP_000035320.1.99700 WP_000035320.1.99759 WP_000035320.1.99768 WP_000035320.1.99777 WP_000035320.1.99802 WP_000035320.1.99830 WP_000035320.1.99849 WP_000035320.1.9985 WP_000035320.1.99850 WP_000035320.1.99859 WP_000035320.1.99860 WP_000035320.1.9987 WP_000035320.1.99884 WP_000035320.1.99888 WP_000035320.1.99901 WP_000035320.1.99934 WP_000035320.1.99950 WP_000035320.1.99955 WP_000035320.1.99956 WP_000035320.1.99963 WP_000035320.1.99979 WP_000035320.1.99984 WP_000035320.1.99985 WP_000035320.1.99999 YP_499589.1.76163 gi|49485931|ref|YP_043152.1| gi|384547279|ref|YP_005736532.1| gi|88194792|ref|YP_499589.1| gi|384549854|ref|YP_005739106.1| gi|29165620|ref|NP_808209.1| gi|470191069|ref|YP_007577379.1| gi|554643826|ref|YP_008715617.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]