SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|537442619|ref|YP_008485196.1| from Staphylococcus aureus subsp. aureus 6850

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|537442619|ref|YP_008485196.1|
Domain Number 1 Region: 12-283
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.2e-77
Family PFOR PP module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|537442619|ref|YP_008485196.1|
Sequence length 288
Comment 2-oxoglutarate ferredoxin oxidoreductase, beta subunit, putative [Staphylococcus aureus subsp. aureus 6850]
Sequence
MATFKDFRNNVKPNWCPGCGDFSVQAAIQKAAANIGLEPEGVAIITGIGCSGRLSGYINS
YGVHSIHGRALPLAQGVKMANKDLTVIASGGDGDGYAIGMGHTIHALRRNMNMTYIVMDN
QIYGLTKGQTSPSSAVGFVTKTTPKGNIEKNVAPLELALSSGATFVAQGFSSDIKGLTKL
IEDAINHDGFSFVNVFSPCVTYNKINTYDWFKEHLTSVDDIENYDSTDKQLATKTIIEHE
SLVTGIVYQDKETPSYESQIKELDDTPLAKRDIKITEDTFNALTEQFI
Download sequence
Identical sequences A0A163SSR3
WP_020977204.1.18273 WP_020977204.1.28501 WP_020977204.1.46608 WP_020977204.1.76294 WP_020977204.1.79379 WP_020977204.1.80206 gi|537442619|ref|YP_008485196.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]