SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|537442826|ref|YP_008485403.1| from Staphylococcus aureus subsp. aureus 6850

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|537442826|ref|YP_008485403.1|
Domain Number 1 Region: 3-326
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.06e-93
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000515
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|537442826|ref|YP_008485403.1|
Sequence length 330
Comment 2-oxoisovalerate dehydrogenase, E1 component, alpha subunit [Staphylococcus aureus subsp. aureus 6850]
Sequence
MIDYKSLGLSEEDLKVIYKWMDLGRKIDERLWLLNRAGKIPFVVSGQGQEATQIGMAYAL
EEGDITAPYYRDLAFVTYMGISAYDTFLSAFGKKDDVNSGGKQMPSHFSSRAKNILSQSS
PVATQIPHAVGAALALKMDGKKKIATATVGEGSSNQGDFHEGLNFAGVHKLPFVCVIINN
KYAISVPDSLQYAAEKLSDRALGYGIHGEQVDGNDPLAMYKAMKEARDRAISGQGSTLIE
AVTSRMTAHSSDDDDQYRTKEEREALKKADCNEKFKKELLSAGIIDDAWLAEIEAEHKDI
INKATKAAEDAPYPSVEEAYAFVYEEGSLN
Download sequence
Identical sequences A0A0H3JMQ4 A0A0H3JRQ8 A0A0H3JXN6 A0A181DFG9 T1YAU4
gi|15924507|ref|NP_372041.1| gi|379021300|ref|YP_005297962.1| gi|545634997|ref|YP_008585567.1| gi|470219028|ref|YP_007619422.1| gi|537442826|ref|YP_008485403.1| gi|537461212|ref|YP_008491652.1| gi|150394069|ref|YP_001316744.1| gi|385781803|ref|YP_005757974.1| gi|15927098|ref|NP_374631.1| gi|269203147|ref|YP_003282416.1| gi|470224816|ref|YP_007623395.1| gi|470222849|ref|YP_007621406.1| gi|470191395|ref|YP_007577705.1| gi|545637856|ref|YP_008588032.1| gi|470193360|ref|YP_007579713.1| gi|148268002|ref|YP_001246945.1| 158878.SAV1517 158879.SA1348 196620.MW1470 282459.SAS1456 359786.SaurJH9_1576 359787.SaurJH1_1609 418127.SAHV_1505 681288.SAAV_1510 gi|470197291|ref|YP_007583692.1| gi|384864740|ref|YP_005750099.1| gi|387150661|ref|YP_005742225.1| gi|49486354|ref|YP_043575.1| gi|470195326|ref|YP_007581678.1| gi|156979836|ref|YP_001442095.1| gi|470199259|ref|YP_007585659.1| WP_000568351.1.10006 WP_000568351.1.100122 WP_000568351.1.10014 WP_000568351.1.100171 WP_000568351.1.100184 WP_000568351.1.100235 WP_000568351.1.10032 WP_000568351.1.100357 WP_000568351.1.100366 WP_000568351.1.100399 WP_000568351.1.10046 WP_000568351.1.100464 WP_000568351.1.10050 WP_000568351.1.100535 WP_000568351.1.100562 WP_000568351.1.100582 WP_000568351.1.100596 WP_000568351.1.100612 WP_000568351.1.100665 WP_000568351.1.100668 WP_000568351.1.100693 WP_000568351.1.100699 WP_000568351.1.100704 WP_000568351.1.100719 WP_000568351.1.100823 WP_000568351.1.100832 WP_000568351.1.100860 WP_000568351.1.100888 WP_000568351.1.100922 WP_000568351.1.100934 WP_000568351.1.10097 WP_000568351.1.101002 WP_000568351.1.101019 WP_000568351.1.101027 WP_000568351.1.101058 WP_000568351.1.101068 WP_000568351.1.101071 WP_000568351.1.101072 WP_000568351.1.101103 WP_000568351.1.10111 WP_000568351.1.101160 WP_000568351.1.101192 WP_000568351.1.101262 WP_000568351.1.101298 WP_000568351.1.101329 WP_000568351.1.101330 WP_000568351.1.101379 WP_000568351.1.101406 WP_000568351.1.101414 WP_000568351.1.101440 WP_000568351.1.101441 WP_000568351.1.10148 WP_000568351.1.101567 WP_000568351.1.101598 WP_000568351.1.101617 WP_000568351.1.10165 WP_000568351.1.101661 WP_000568351.1.101691 WP_000568351.1.101704 WP_000568351.1.101728 WP_000568351.1.101745 WP_000568351.1.101778 WP_000568351.1.101813 WP_000568351.1.101820 WP_000568351.1.101825 WP_000568351.1.101852 WP_000568351.1.101902 WP_000568351.1.101906 WP_000568351.1.101922 WP_000568351.1.101943 WP_000568351.1.102065 WP_000568351.1.102066 WP_000568351.1.102070 WP_000568351.1.102096 WP_000568351.1.102123 WP_000568351.1.102130 WP_000568351.1.102132 WP_000568351.1.10238 WP_000568351.1.1025 WP_000568351.1.10274 WP_000568351.1.10301 WP_000568351.1.10306 WP_000568351.1.1031 WP_000568351.1.10343 WP_000568351.1.10355 WP_000568351.1.1043 WP_000568351.1.10436 WP_000568351.1.10478 WP_000568351.1.10481 WP_000568351.1.10526 WP_000568351.1.10583 WP_000568351.1.10624 WP_000568351.1.10644 WP_000568351.1.10749 WP_000568351.1.10751 WP_000568351.1.1077 WP_000568351.1.10823 WP_000568351.1.10841 WP_000568351.1.10858 WP_000568351.1.10919 WP_000568351.1.10928 WP_000568351.1.10942 WP_000568351.1.10976 WP_000568351.1.10979 WP_000568351.1.10985 WP_000568351.1.11001 WP_000568351.1.11069 WP_000568351.1.11073 WP_000568351.1.11083 WP_000568351.1.11084 WP_000568351.1.1115 WP_000568351.1.11162 WP_000568351.1.11220 WP_000568351.1.11228 WP_000568351.1.11261 WP_000568351.1.11282 WP_000568351.1.11286 WP_000568351.1.11322 WP_000568351.1.11333 WP_000568351.1.11378 WP_000568351.1.11403 WP_000568351.1.11447 WP_000568351.1.11451 WP_000568351.1.11463 WP_000568351.1.1147 WP_000568351.1.11504 WP_000568351.1.11513 WP_000568351.1.11556 WP_000568351.1.11611 WP_000568351.1.11640 WP_000568351.1.11646 WP_000568351.1.11663 WP_000568351.1.1171 WP_000568351.1.11730 WP_000568351.1.11736 WP_000568351.1.11768 WP_000568351.1.11794 WP_000568351.1.11816 WP_000568351.1.11837 WP_000568351.1.11884 WP_000568351.1.11903 WP_000568351.1.12019 WP_000568351.1.12042 WP_000568351.1.1210 WP_000568351.1.12149 WP_000568351.1.12152 WP_000568351.1.12170 WP_000568351.1.12175 WP_000568351.1.12234 WP_000568351.1.12256 WP_000568351.1.12272 WP_000568351.1.12330 WP_000568351.1.12361 WP_000568351.1.12366 WP_000568351.1.12391 WP_000568351.1.12436 WP_000568351.1.12437 WP_000568351.1.12508 WP_000568351.1.1252 WP_000568351.1.1257 WP_000568351.1.12598 WP_000568351.1.12608 WP_000568351.1.12618 WP_000568351.1.12685 WP_000568351.1.12733 WP_000568351.1.12737 WP_000568351.1.12770 WP_000568351.1.12780 WP_000568351.1.12788 WP_000568351.1.12829 WP_000568351.1.12858 WP_000568351.1.12884 WP_000568351.1.12904 WP_000568351.1.12920 WP_000568351.1.13013 WP_000568351.1.13062 WP_000568351.1.13154 WP_000568351.1.13164 WP_000568351.1.13169 WP_000568351.1.13189 WP_000568351.1.13243 WP_000568351.1.13250 WP_000568351.1.13303 WP_000568351.1.13317 WP_000568351.1.13326 WP_000568351.1.13355 WP_000568351.1.13379 WP_000568351.1.13405 WP_000568351.1.13448 WP_000568351.1.13514 WP_000568351.1.13554 WP_000568351.1.13612 WP_000568351.1.13665 WP_000568351.1.13668 WP_000568351.1.13670 WP_000568351.1.13733 WP_000568351.1.13879 WP_000568351.1.13897 WP_000568351.1.13933 WP_000568351.1.13986 WP_000568351.1.13987 WP_000568351.1.14025 WP_000568351.1.14076 WP_000568351.1.14097 WP_000568351.1.14143 WP_000568351.1.14163 WP_000568351.1.1420 WP_000568351.1.14201 WP_000568351.1.1425 WP_000568351.1.1429 WP_000568351.1.14305 WP_000568351.1.14342 WP_000568351.1.14358 WP_000568351.1.14397 WP_000568351.1.14412 WP_000568351.1.14535 WP_000568351.1.1457 WP_000568351.1.14577 WP_000568351.1.14596 WP_000568351.1.14639 WP_000568351.1.1468 WP_000568351.1.14696 WP_000568351.1.1471 WP_000568351.1.14729 WP_000568351.1.14774 WP_000568351.1.14782 WP_000568351.1.14825 WP_000568351.1.14846 WP_000568351.1.14874 WP_000568351.1.14970 WP_000568351.1.15015 WP_000568351.1.15029 WP_000568351.1.15098 WP_000568351.1.15108 WP_000568351.1.15173 WP_000568351.1.15185 WP_000568351.1.1520 WP_000568351.1.15201 WP_000568351.1.15241 WP_000568351.1.1525 WP_000568351.1.15268 WP_000568351.1.15269 WP_000568351.1.15294 WP_000568351.1.15296 WP_000568351.1.15389 WP_000568351.1.15403 WP_000568351.1.15421 WP_000568351.1.15507 WP_000568351.1.15533 WP_000568351.1.15544 WP_000568351.1.15546 WP_000568351.1.1558 WP_000568351.1.15590 WP_000568351.1.1564 WP_000568351.1.15691 WP_000568351.1.15722 WP_000568351.1.15753 WP_000568351.1.15785 WP_000568351.1.15812 WP_000568351.1.159 WP_000568351.1.15920 WP_000568351.1.15921 WP_000568351.1.15925 WP_000568351.1.16018 WP_000568351.1.16068 WP_000568351.1.16096 WP_000568351.1.16098 WP_000568351.1.16114 WP_000568351.1.16140 WP_000568351.1.16173 WP_000568351.1.16195 WP_000568351.1.16203 WP_000568351.1.16223 WP_000568351.1.1623 WP_000568351.1.16251 WP_000568351.1.16265 WP_000568351.1.16276 WP_000568351.1.16311 WP_000568351.1.16395 WP_000568351.1.16407 WP_000568351.1.16455 WP_000568351.1.16458 WP_000568351.1.16467 WP_000568351.1.16589 WP_000568351.1.16632 WP_000568351.1.16639 WP_000568351.1.1665 WP_000568351.1.16651 WP_000568351.1.16653 WP_000568351.1.16693 WP_000568351.1.16747 WP_000568351.1.16761 WP_000568351.1.16794 WP_000568351.1.16815 WP_000568351.1.16824 WP_000568351.1.16880 WP_000568351.1.16882 WP_000568351.1.16920 WP_000568351.1.16925 WP_000568351.1.16969 WP_000568351.1.170 WP_000568351.1.17012 WP_000568351.1.17046 WP_000568351.1.17050 WP_000568351.1.17080 WP_000568351.1.17122 WP_000568351.1.17132 WP_000568351.1.17139 WP_000568351.1.17157 WP_000568351.1.17180 WP_000568351.1.17240 WP_000568351.1.17289 WP_000568351.1.1729 WP_000568351.1.17309 WP_000568351.1.17327 WP_000568351.1.1736 WP_000568351.1.1740 WP_000568351.1.1741 WP_000568351.1.17419 WP_000568351.1.17454 WP_000568351.1.17456 WP_000568351.1.17529 WP_000568351.1.17531 WP_000568351.1.1756 WP_000568351.1.17590 WP_000568351.1.17643 WP_000568351.1.1765 WP_000568351.1.17671 WP_000568351.1.17717 WP_000568351.1.17718 WP_000568351.1.17725 WP_000568351.1.17737 WP_000568351.1.17796 WP_000568351.1.17818 WP_000568351.1.17832 WP_000568351.1.17847 WP_000568351.1.17853 WP_000568351.1.17909 WP_000568351.1.17922 WP_000568351.1.17943 WP_000568351.1.17987 WP_000568351.1.18011 WP_000568351.1.18069 WP_000568351.1.18080 WP_000568351.1.18113 WP_000568351.1.18140 WP_000568351.1.18203 WP_000568351.1.18237 WP_000568351.1.18248 WP_000568351.1.18261 WP_000568351.1.18273 WP_000568351.1.18288 WP_000568351.1.1829 WP_000568351.1.18301 WP_000568351.1.18309 WP_000568351.1.18310 WP_000568351.1.18360 WP_000568351.1.18412 WP_000568351.1.1847 WP_000568351.1.18487 WP_000568351.1.18506 WP_000568351.1.18507 WP_000568351.1.18527 WP_000568351.1.18539 WP_000568351.1.18560 WP_000568351.1.18570 WP_000568351.1.18591 WP_000568351.1.18632 WP_000568351.1.18679 WP_000568351.1.18741 WP_000568351.1.18777 WP_000568351.1.18792 WP_000568351.1.18818 WP_000568351.1.18819 WP_000568351.1.18834 WP_000568351.1.18882 WP_000568351.1.1892 WP_000568351.1.18965 WP_000568351.1.18968 WP_000568351.1.18974 WP_000568351.1.19022 WP_000568351.1.19052 WP_000568351.1.19082 WP_000568351.1.1911 WP_000568351.1.19301 WP_000568351.1.19322 WP_000568351.1.19399 WP_000568351.1.19430 WP_000568351.1.19450 WP_000568351.1.19555 WP_000568351.1.19575 WP_000568351.1.19577 WP_000568351.1.19611 WP_000568351.1.1964 WP_000568351.1.19643 WP_000568351.1.19701 WP_000568351.1.19732 WP_000568351.1.1974 WP_000568351.1.19748 WP_000568351.1.19788 WP_000568351.1.19792 WP_000568351.1.19816 WP_000568351.1.19848 WP_000568351.1.19891 WP_000568351.1.19912 WP_000568351.1.19921 WP_000568351.1.19977 WP_000568351.1.19980 WP_000568351.1.19981 WP_000568351.1.19982 WP_000568351.1.20006 WP_000568351.1.20049 WP_000568351.1.20052 WP_000568351.1.2007 WP_000568351.1.20078 WP_000568351.1.2008 WP_000568351.1.20090 WP_000568351.1.20100 WP_000568351.1.20156 WP_000568351.1.20161 WP_000568351.1.20167 WP_000568351.1.20177 WP_000568351.1.20191 WP_000568351.1.20214 WP_000568351.1.20245 WP_000568351.1.2029 WP_000568351.1.20324 WP_000568351.1.20340 WP_000568351.1.20394 WP_000568351.1.20398 WP_000568351.1.20399 WP_000568351.1.20411 WP_000568351.1.20447 WP_000568351.1.20479 WP_000568351.1.20487 WP_000568351.1.20579 WP_000568351.1.20585 WP_000568351.1.20611 WP_000568351.1.20619 WP_000568351.1.20620 WP_000568351.1.20649 WP_000568351.1.20661 WP_000568351.1.20690 WP_000568351.1.20736 WP_000568351.1.20796 WP_000568351.1.20821 WP_000568351.1.20846 WP_000568351.1.20867 WP_000568351.1.20878 WP_000568351.1.20913 WP_000568351.1.20922 WP_000568351.1.20935 WP_000568351.1.20939 WP_000568351.1.20945 WP_000568351.1.20971 WP_000568351.1.21056 WP_000568351.1.21066 WP_000568351.1.21078 WP_000568351.1.21109 WP_000568351.1.21111 WP_000568351.1.21154 WP_000568351.1.21183 WP_000568351.1.2119 WP_000568351.1.21257 WP_000568351.1.21272 WP_000568351.1.2129 WP_000568351.1.21313 WP_000568351.1.21330 WP_000568351.1.21339 WP_000568351.1.2135 WP_000568351.1.21359 WP_000568351.1.21375 WP_000568351.1.21379 WP_000568351.1.21393 WP_000568351.1.21412 WP_000568351.1.21449 WP_000568351.1.21458 WP_000568351.1.21464 WP_000568351.1.21480 WP_000568351.1.21500 WP_000568351.1.21511 WP_000568351.1.21514 WP_000568351.1.21572 WP_000568351.1.2159 WP_000568351.1.21621 WP_000568351.1.21636 WP_000568351.1.21724 WP_000568351.1.21746 WP_000568351.1.21763 WP_000568351.1.2178 WP_000568351.1.21787 WP_000568351.1.21830 WP_000568351.1.21988 WP_000568351.1.22027 WP_000568351.1.22065 WP_000568351.1.22082 WP_000568351.1.22111 WP_000568351.1.22177 WP_000568351.1.22197 WP_000568351.1.22227 WP_000568351.1.22302 WP_000568351.1.22369 WP_000568351.1.22400 WP_000568351.1.22493 WP_000568351.1.22531 WP_000568351.1.22533 WP_000568351.1.22547 WP_000568351.1.22559 WP_000568351.1.22650 WP_000568351.1.22696 WP_000568351.1.22702 WP_000568351.1.22709 WP_000568351.1.22738 WP_000568351.1.22789 WP_000568351.1.22790 WP_000568351.1.22792 WP_000568351.1.22803 WP_000568351.1.22853 WP_000568351.1.22861 WP_000568351.1.22869 WP_000568351.1.22890 WP_000568351.1.22924 WP_000568351.1.22969 WP_000568351.1.23008 WP_000568351.1.23048 WP_000568351.1.23061 WP_000568351.1.23103 WP_000568351.1.23121 WP_000568351.1.23130 WP_000568351.1.23132 WP_000568351.1.23133 WP_000568351.1.23161 WP_000568351.1.23185 WP_000568351.1.23222 WP_000568351.1.23244 WP_000568351.1.2327 WP_000568351.1.23275 WP_000568351.1.23288 WP_000568351.1.23413 WP_000568351.1.23439 WP_000568351.1.23449 WP_000568351.1.23531 WP_000568351.1.23572 WP_000568351.1.23580 WP_000568351.1.23630 WP_000568351.1.23644 WP_000568351.1.23690 WP_000568351.1.23710 WP_000568351.1.23740 WP_000568351.1.23796 WP_000568351.1.23809 WP_000568351.1.23842 WP_000568351.1.2389 WP_000568351.1.23900 WP_000568351.1.23902 WP_000568351.1.23956 WP_000568351.1.23972 WP_000568351.1.23995 WP_000568351.1.24000 WP_000568351.1.24129 WP_000568351.1.24207 WP_000568351.1.24213 WP_000568351.1.24263 WP_000568351.1.2427 WP_000568351.1.24277 WP_000568351.1.2434 WP_000568351.1.24343 WP_000568351.1.24437 WP_000568351.1.24469 WP_000568351.1.2450 WP_000568351.1.24503 WP_000568351.1.24519 WP_000568351.1.24589 WP_000568351.1.24596 WP_000568351.1.24602 WP_000568351.1.24631 WP_000568351.1.24679 WP_000568351.1.24684 WP_000568351.1.24855 WP_000568351.1.24903 WP_000568351.1.2497 WP_000568351.1.25007 WP_000568351.1.2501 WP_000568351.1.25012 WP_000568351.1.2506 WP_000568351.1.25070 WP_000568351.1.25092 WP_000568351.1.25095 WP_000568351.1.25098 WP_000568351.1.25115 WP_000568351.1.25120 WP_000568351.1.25145 WP_000568351.1.25167 WP_000568351.1.25209 WP_000568351.1.25287 WP_000568351.1.25331 WP_000568351.1.25361 WP_000568351.1.25433 WP_000568351.1.25459 WP_000568351.1.25489 WP_000568351.1.2552 WP_000568351.1.25557 WP_000568351.1.25595 WP_000568351.1.25621 WP_000568351.1.25623 WP_000568351.1.25633 WP_000568351.1.25721 WP_000568351.1.25758 WP_000568351.1.25772 WP_000568351.1.25779 WP_000568351.1.25801 WP_000568351.1.25802 WP_000568351.1.25840 WP_000568351.1.25856 WP_000568351.1.25857 WP_000568351.1.2590 WP_000568351.1.25910 WP_000568351.1.2592 WP_000568351.1.25930 WP_000568351.1.25955 WP_000568351.1.26039 WP_000568351.1.2608 WP_000568351.1.26086 WP_000568351.1.26106 WP_000568351.1.26143 WP_000568351.1.26169 WP_000568351.1.2621 WP_000568351.1.26226 WP_000568351.1.26255 WP_000568351.1.26266 WP_000568351.1.26276 WP_000568351.1.26290 WP_000568351.1.26298 WP_000568351.1.26314 WP_000568351.1.26318 WP_000568351.1.2633 WP_000568351.1.26340 WP_000568351.1.26345 WP_000568351.1.26354 WP_000568351.1.26359 WP_000568351.1.26364 WP_000568351.1.26399 WP_000568351.1.26404 WP_000568351.1.2643 WP_000568351.1.26506 WP_000568351.1.26677 WP_000568351.1.26692 WP_000568351.1.26726 WP_000568351.1.2674 WP_000568351.1.26751 WP_000568351.1.26772 WP_000568351.1.26804 WP_000568351.1.2684 WP_000568351.1.26840 WP_000568351.1.26865 WP_000568351.1.26884 WP_000568351.1.2689 WP_000568351.1.26903 WP_000568351.1.26905 WP_000568351.1.26938 WP_000568351.1.26944 WP_000568351.1.27013 WP_000568351.1.27053 WP_000568351.1.27083 WP_000568351.1.27166 WP_000568351.1.27170 WP_000568351.1.27182 WP_000568351.1.2719 WP_000568351.1.27207 WP_000568351.1.2725 WP_000568351.1.27262 WP_000568351.1.27293 WP_000568351.1.27294 WP_000568351.1.27323 WP_000568351.1.27379 WP_000568351.1.27387 WP_000568351.1.27447 WP_000568351.1.27448 WP_000568351.1.27456 WP_000568351.1.27468 WP_000568351.1.2753 WP_000568351.1.27539 WP_000568351.1.27590 WP_000568351.1.27628 WP_000568351.1.27640 WP_000568351.1.27646 WP_000568351.1.27689 WP_000568351.1.27739 WP_000568351.1.27744 WP_000568351.1.27765 WP_000568351.1.27793 WP_000568351.1.27830 WP_000568351.1.27834 WP_000568351.1.2795 WP_000568351.1.28016 WP_000568351.1.28091 WP_000568351.1.28105 WP_000568351.1.28173 WP_000568351.1.28213 WP_000568351.1.28226 WP_000568351.1.28230 WP_000568351.1.28253 WP_000568351.1.28257 WP_000568351.1.28274 WP_000568351.1.28315 WP_000568351.1.28319 WP_000568351.1.28334 WP_000568351.1.28347 WP_000568351.1.28399 WP_000568351.1.28400 WP_000568351.1.28430 WP_000568351.1.28501 WP_000568351.1.2852 WP_000568351.1.28578 WP_000568351.1.28580 WP_000568351.1.28605 WP_000568351.1.28652 WP_000568351.1.28690 WP_000568351.1.28720 WP_000568351.1.28763 WP_000568351.1.28784 WP_000568351.1.28785 WP_000568351.1.28848 WP_000568351.1.28871 WP_000568351.1.28909 WP_000568351.1.28915 WP_000568351.1.28981 WP_000568351.1.28987 WP_000568351.1.29014 WP_000568351.1.29052 WP_000568351.1.29060 WP_000568351.1.29112 WP_000568351.1.29155 WP_000568351.1.29166 WP_000568351.1.29187 WP_000568351.1.29226 WP_000568351.1.29242 WP_000568351.1.29263 WP_000568351.1.29276 WP_000568351.1.29315 WP_000568351.1.29329 WP_000568351.1.29366 WP_000568351.1.29368 WP_000568351.1.29395 WP_000568351.1.29420 WP_000568351.1.29468 WP_000568351.1.29522 WP_000568351.1.29553 WP_000568351.1.2957 WP_000568351.1.29716 WP_000568351.1.2972 WP_000568351.1.29736 WP_000568351.1.29744 WP_000568351.1.29788 WP_000568351.1.2981 WP_000568351.1.29826 WP_000568351.1.29862 WP_000568351.1.29902 WP_000568351.1.29905 WP_000568351.1.29918 WP_000568351.1.29956 WP_000568351.1.29981 WP_000568351.1.30051 WP_000568351.1.30089 WP_000568351.1.30095 WP_000568351.1.30100 WP_000568351.1.30115 WP_000568351.1.30152 WP_000568351.1.30186 WP_000568351.1.30197 WP_000568351.1.30204 WP_000568351.1.30209 WP_000568351.1.30249 WP_000568351.1.30268 WP_000568351.1.30302 WP_000568351.1.30307 WP_000568351.1.30328 WP_000568351.1.30350 WP_000568351.1.30364 WP_000568351.1.30458 WP_000568351.1.30496 WP_000568351.1.30508 WP_000568351.1.30531 WP_000568351.1.30560 WP_000568351.1.30622 WP_000568351.1.30645 WP_000568351.1.30646 WP_000568351.1.30666 WP_000568351.1.30702 WP_000568351.1.30720 WP_000568351.1.30763 WP_000568351.1.3077 WP_000568351.1.30845 WP_000568351.1.30847 WP_000568351.1.30854 WP_000568351.1.30962 WP_000568351.1.31005 WP_000568351.1.31022 WP_000568351.1.31039 WP_000568351.1.31048 WP_000568351.1.31091 WP_000568351.1.31176 WP_000568351.1.31204 WP_000568351.1.31206 WP_000568351.1.31212 WP_000568351.1.31315 WP_000568351.1.31337 WP_000568351.1.31339 WP_000568351.1.31355 WP_000568351.1.31426 WP_000568351.1.31436 WP_000568351.1.31437 WP_000568351.1.31442 WP_000568351.1.31468 WP_000568351.1.31479 WP_000568351.1.31505 WP_000568351.1.31529 WP_000568351.1.31539 WP_000568351.1.31621 WP_000568351.1.31642 WP_000568351.1.31647 WP_000568351.1.31653 WP_000568351.1.31686 WP_000568351.1.31753 WP_000568351.1.31791 WP_000568351.1.31827 WP_000568351.1.31828 WP_000568351.1.31842 WP_000568351.1.31892 WP_000568351.1.31931 WP_000568351.1.31997 WP_000568351.1.32003 WP_000568351.1.32005 WP_000568351.1.32029 WP_000568351.1.32040 WP_000568351.1.32067 WP_000568351.1.32130 WP_000568351.1.32160 WP_000568351.1.32207 WP_000568351.1.3229 WP_000568351.1.32339 WP_000568351.1.3242 WP_000568351.1.32481 WP_000568351.1.32483 WP_000568351.1.32514 WP_000568351.1.32534 WP_000568351.1.32565 WP_000568351.1.32584 WP_000568351.1.32607 WP_000568351.1.32634 WP_000568351.1.32645 WP_000568351.1.32746 WP_000568351.1.32764 WP_000568351.1.32770 WP_000568351.1.32800 WP_000568351.1.32928 WP_000568351.1.32939 WP_000568351.1.32954 WP_000568351.1.33038 WP_000568351.1.33048 WP_000568351.1.33067 WP_000568351.1.33110 WP_000568351.1.33123 WP_000568351.1.33138 WP_000568351.1.33172 WP_000568351.1.33212 WP_000568351.1.33250 WP_000568351.1.33266 WP_000568351.1.33292 WP_000568351.1.33296 WP_000568351.1.33335 WP_000568351.1.33357 WP_000568351.1.3341 WP_000568351.1.33416 WP_000568351.1.33432 WP_000568351.1.33468 WP_000568351.1.3347 WP_000568351.1.33507 WP_000568351.1.33594 WP_000568351.1.33626 WP_000568351.1.33627 WP_000568351.1.3363 WP_000568351.1.33640 WP_000568351.1.33654 WP_000568351.1.33692 WP_000568351.1.33695 WP_000568351.1.33718 WP_000568351.1.33735 WP_000568351.1.33743 WP_000568351.1.33765 WP_000568351.1.33769 WP_000568351.1.33792 WP_000568351.1.33804 WP_000568351.1.33813 WP_000568351.1.33816 WP_000568351.1.33940 WP_000568351.1.33963 WP_000568351.1.33966 WP_000568351.1.33968 WP_000568351.1.33971 WP_000568351.1.33983 WP_000568351.1.34026 WP_000568351.1.34030 WP_000568351.1.34051 WP_000568351.1.34062 WP_000568351.1.34080 WP_000568351.1.34100 WP_000568351.1.34132 WP_000568351.1.34182 WP_000568351.1.34209 WP_000568351.1.34223 WP_000568351.1.34244 WP_000568351.1.34250 WP_000568351.1.34251 WP_000568351.1.34280 WP_000568351.1.34285 WP_000568351.1.34334 WP_000568351.1.34381 WP_000568351.1.34403 WP_000568351.1.34410 WP_000568351.1.34436 WP_000568351.1.3448 WP_000568351.1.34482 WP_000568351.1.34492 WP_000568351.1.34502 WP_000568351.1.34510 WP_000568351.1.34526 WP_000568351.1.3461 WP_000568351.1.34620 WP_000568351.1.34677 WP_000568351.1.34737 WP_000568351.1.34767 WP_000568351.1.34818 WP_000568351.1.34890 WP_000568351.1.34918 WP_000568351.1.34998 WP_000568351.1.35059 WP_000568351.1.35062 WP_000568351.1.35089 WP_000568351.1.35097 WP_000568351.1.35110 WP_000568351.1.35121 WP_000568351.1.35233 WP_000568351.1.35276 WP_000568351.1.35285 WP_000568351.1.35297 WP_000568351.1.35307 WP_000568351.1.35334 WP_000568351.1.35342 WP_000568351.1.354 WP_000568351.1.35415 WP_000568351.1.3547 WP_000568351.1.35498 WP_000568351.1.35525 WP_000568351.1.35580 WP_000568351.1.35615 WP_000568351.1.35623 WP_000568351.1.35659 WP_000568351.1.35673 WP_000568351.1.3569 WP_000568351.1.35801 WP_000568351.1.35826 WP_000568351.1.35900 WP_000568351.1.35928 WP_000568351.1.35950 WP_000568351.1.36004 WP_000568351.1.36082 WP_000568351.1.36102 WP_000568351.1.36119 WP_000568351.1.36141 WP_000568351.1.3617 WP_000568351.1.36176 WP_000568351.1.36187 WP_000568351.1.36188 WP_000568351.1.36250 WP_000568351.1.36264 WP_000568351.1.36278 WP_000568351.1.36282 WP_000568351.1.36307 WP_000568351.1.36344 WP_000568351.1.36389 WP_000568351.1.36532 WP_000568351.1.36535 WP_000568351.1.3655 WP_000568351.1.36570 WP_000568351.1.36580 WP_000568351.1.36600 WP_000568351.1.36615 WP_000568351.1.36646 WP_000568351.1.3666 WP_000568351.1.36669 WP_000568351.1.36689 WP_000568351.1.36697 WP_000568351.1.36745 WP_000568351.1.3675 WP_000568351.1.36783 WP_000568351.1.36793 WP_000568351.1.36796 WP_000568351.1.36822 WP_000568351.1.3685 WP_000568351.1.36858 WP_000568351.1.3687 WP_000568351.1.36932 WP_000568351.1.36955 WP_000568351.1.36979 WP_000568351.1.36983 WP_000568351.1.36997 WP_000568351.1.37002 WP_000568351.1.37016 WP_000568351.1.3703 WP_000568351.1.37044 WP_000568351.1.37055 WP_000568351.1.37075 WP_000568351.1.37080 WP_000568351.1.37121 WP_000568351.1.37134 WP_000568351.1.37220 WP_000568351.1.37341 WP_000568351.1.37398 WP_000568351.1.37408 WP_000568351.1.37424 WP_000568351.1.37467 WP_000568351.1.37583 WP_000568351.1.37602 WP_000568351.1.37605 WP_000568351.1.37606 WP_000568351.1.37621 WP_000568351.1.37624 WP_000568351.1.37781 WP_000568351.1.37815 WP_000568351.1.37828 WP_000568351.1.37953 WP_000568351.1.37987 WP_000568351.1.38038 WP_000568351.1.38057 WP_000568351.1.38070 WP_000568351.1.38082 WP_000568351.1.3809 WP_000568351.1.38100 WP_000568351.1.38160 WP_000568351.1.38177 WP_000568351.1.3820 WP_000568351.1.38212 WP_000568351.1.38230 WP_000568351.1.38232 WP_000568351.1.38276 WP_000568351.1.38282 WP_000568351.1.38309 WP_000568351.1.38316 WP_000568351.1.38339 WP_000568351.1.38383 WP_000568351.1.38390 WP_000568351.1.3842 WP_000568351.1.38422 WP_000568351.1.38435 WP_000568351.1.38437 WP_000568351.1.38453 WP_000568351.1.38493 WP_000568351.1.3852 WP_000568351.1.38522 WP_000568351.1.38546 WP_000568351.1.38607 WP_000568351.1.38612 WP_000568351.1.38658 WP_000568351.1.3867 WP_000568351.1.38674 WP_000568351.1.38721 WP_000568351.1.38760 WP_000568351.1.38823 WP_000568351.1.38841 WP_000568351.1.38858 WP_000568351.1.38862 WP_000568351.1.38926 WP_000568351.1.38931 WP_000568351.1.38940 WP_000568351.1.38941 WP_000568351.1.38960 WP_000568351.1.38972 WP_000568351.1.38989 WP_000568351.1.390 WP_000568351.1.39012 WP_000568351.1.39014 WP_000568351.1.39043 WP_000568351.1.39053 WP_000568351.1.3906 WP_000568351.1.391 WP_000568351.1.39108 WP_000568351.1.39173 WP_000568351.1.39203 WP_000568351.1.39206 WP_000568351.1.39217 WP_000568351.1.3926 WP_000568351.1.39272 WP_000568351.1.39290 WP_000568351.1.39324 WP_000568351.1.39332 WP_000568351.1.39333 WP_000568351.1.39384 WP_000568351.1.39397 WP_000568351.1.39406 WP_000568351.1.39486 WP_000568351.1.39494 WP_000568351.1.39506 WP_000568351.1.39527 WP_000568351.1.39550 WP_000568351.1.39645 WP_000568351.1.39687 WP_000568351.1.39689 WP_000568351.1.39697 WP_000568351.1.39711 WP_000568351.1.39738 WP_000568351.1.39767 WP_000568351.1.39789 WP_000568351.1.39832 WP_000568351.1.39838 WP_000568351.1.39856 WP_000568351.1.39869 WP_000568351.1.40014 WP_000568351.1.40043 WP_000568351.1.40082 WP_000568351.1.40099 WP_000568351.1.40120 WP_000568351.1.40137 WP_000568351.1.4015 WP_000568351.1.40164 WP_000568351.1.40173 WP_000568351.1.4019 WP_000568351.1.40299 WP_000568351.1.40318 WP_000568351.1.40320 WP_000568351.1.40330 WP_000568351.1.40340 WP_000568351.1.40342 WP_000568351.1.40368 WP_000568351.1.40406 WP_000568351.1.40409 WP_000568351.1.4045 WP_000568351.1.40474 WP_000568351.1.40481 WP_000568351.1.40505 WP_000568351.1.40531 WP_000568351.1.40532 WP_000568351.1.4056 WP_000568351.1.4057 WP_000568351.1.40579 WP_000568351.1.40588 WP_000568351.1.40620 WP_000568351.1.40644 WP_000568351.1.40655 WP_000568351.1.40658 WP_000568351.1.40659 WP_000568351.1.40760 WP_000568351.1.4078 WP_000568351.1.40797 WP_000568351.1.40816 WP_000568351.1.41064 WP_000568351.1.41094 WP_000568351.1.41119 WP_000568351.1.41129 WP_000568351.1.4115 WP_000568351.1.41178 WP_000568351.1.412 WP_000568351.1.41208 WP_000568351.1.41241 WP_000568351.1.41255 WP_000568351.1.41289 WP_000568351.1.4129 WP_000568351.1.41426 WP_000568351.1.41432 WP_000568351.1.41433 WP_000568351.1.41458 WP_000568351.1.41499 WP_000568351.1.41511 WP_000568351.1.41558 WP_000568351.1.41567 WP_000568351.1.41582 WP_000568351.1.41623 WP_000568351.1.41674 WP_000568351.1.41839 WP_000568351.1.4188 WP_000568351.1.41898 WP_000568351.1.41935 WP_000568351.1.41943 WP_000568351.1.41983 WP_000568351.1.41989 WP_000568351.1.420 WP_000568351.1.42015 WP_000568351.1.42017 WP_000568351.1.42028 WP_000568351.1.42064 WP_000568351.1.42087 WP_000568351.1.42125 WP_000568351.1.42137 WP_000568351.1.42198 WP_000568351.1.42230 WP_000568351.1.42269 WP_000568351.1.42286 WP_000568351.1.42305 WP_000568351.1.42355 WP_000568351.1.42403 WP_000568351.1.42436 WP_000568351.1.42459 WP_000568351.1.42481 WP_000568351.1.42510 WP_000568351.1.42593 WP_000568351.1.426 WP_000568351.1.42640 WP_000568351.1.42652 WP_000568351.1.42668 WP_000568351.1.42674 WP_000568351.1.42737 WP_000568351.1.42759 WP_000568351.1.42786 WP_000568351.1.42837 WP_000568351.1.42883 WP_000568351.1.42897 WP_000568351.1.4293 WP_000568351.1.42985 WP_000568351.1.4299 WP_000568351.1.43014 WP_000568351.1.43047 WP_000568351.1.43072 WP_000568351.1.43122 WP_000568351.1.43131 WP_000568351.1.43134 WP_000568351.1.43143 WP_000568351.1.43147 WP_000568351.1.43159 WP_000568351.1.43165 WP_000568351.1.43202 WP_000568351.1.43232 WP_000568351.1.43248 WP_000568351.1.4325 WP_000568351.1.43263 WP_000568351.1.4327 WP_000568351.1.43274 WP_000568351.1.43323 WP_000568351.1.43331 WP_000568351.1.43341 WP_000568351.1.43349 WP_000568351.1.43369 WP_000568351.1.4337 WP_000568351.1.43406 WP_000568351.1.4341 WP_000568351.1.43410 WP_000568351.1.43414 WP_000568351.1.43460 WP_000568351.1.4347 WP_000568351.1.43530 WP_000568351.1.43550 WP_000568351.1.43560 WP_000568351.1.43617 WP_000568351.1.43618 WP_000568351.1.43627 WP_000568351.1.43659 WP_000568351.1.43670 WP_000568351.1.43683 WP_000568351.1.43693 WP_000568351.1.43702 WP_000568351.1.43703 WP_000568351.1.4372 WP_000568351.1.43731 WP_000568351.1.43752 WP_000568351.1.43788 WP_000568351.1.43819 WP_000568351.1.43827 WP_000568351.1.4385 WP_000568351.1.43851 WP_000568351.1.43915 WP_000568351.1.43964 WP_000568351.1.44095 WP_000568351.1.44119 WP_000568351.1.44153 WP_000568351.1.44181 WP_000568351.1.44195 WP_000568351.1.44265 WP_000568351.1.44302 WP_000568351.1.44388 WP_000568351.1.44396 WP_000568351.1.44405 WP_000568351.1.44420 WP_000568351.1.44544 WP_000568351.1.44579 WP_000568351.1.44588 WP_000568351.1.44605 WP_000568351.1.44631 WP_000568351.1.44672 WP_000568351.1.44732 WP_000568351.1.44755 WP_000568351.1.44780 WP_000568351.1.44785 WP_000568351.1.44788 WP_000568351.1.44796 WP_000568351.1.44881 WP_000568351.1.44882 WP_000568351.1.44899 WP_000568351.1.44914 WP_000568351.1.44969 WP_000568351.1.45033 WP_000568351.1.45035 WP_000568351.1.45050 WP_000568351.1.45099 WP_000568351.1.4513 WP_000568351.1.45132 WP_000568351.1.45133 WP_000568351.1.45164 WP_000568351.1.45170 WP_000568351.1.452 WP_000568351.1.45272 WP_000568351.1.45290 WP_000568351.1.45297 WP_000568351.1.453 WP_000568351.1.45364 WP_000568351.1.45419 WP_000568351.1.45431 WP_000568351.1.45439 WP_000568351.1.45472 WP_000568351.1.45492 WP_000568351.1.4550 WP_000568351.1.45507 WP_000568351.1.45560 WP_000568351.1.45577 WP_000568351.1.45620 WP_000568351.1.45654 WP_000568351.1.45670 WP_000568351.1.45698 WP_000568351.1.45703 WP_000568351.1.45730 WP_000568351.1.45768 WP_000568351.1.45771 WP_000568351.1.45780 WP_000568351.1.45833 WP_000568351.1.4584 WP_000568351.1.45852 WP_000568351.1.45897 WP_000568351.1.45954 WP_000568351.1.4598 WP_000568351.1.46003 WP_000568351.1.46005 WP_000568351.1.46021 WP_000568351.1.46055 WP_000568351.1.46082 WP_000568351.1.46087 WP_000568351.1.46168 WP_000568351.1.46195 WP_000568351.1.46208 WP_000568351.1.46222 WP_000568351.1.46228 WP_000568351.1.46259 WP_000568351.1.46276 WP_000568351.1.46289 WP_000568351.1.46330 WP_000568351.1.46334 WP_000568351.1.46362 WP_000568351.1.46368 WP_000568351.1.46380 WP_000568351.1.46401 WP_000568351.1.46418 WP_000568351.1.46422 WP_000568351.1.46465 WP_000568351.1.46514 WP_000568351.1.46543 WP_000568351.1.46608 WP_000568351.1.4662 WP_000568351.1.46660 WP_000568351.1.46664 WP_000568351.1.46670 WP_000568351.1.46676 WP_000568351.1.46692 WP_000568351.1.46702 WP_000568351.1.46703 WP_000568351.1.46752 WP_000568351.1.46765 WP_000568351.1.46815 WP_000568351.1.46852 WP_000568351.1.46881 WP_000568351.1.46908 WP_000568351.1.46911 WP_000568351.1.46925 WP_000568351.1.46937 WP_000568351.1.4696 WP_000568351.1.46983 WP_000568351.1.46995 WP_000568351.1.47051 WP_000568351.1.47090 WP_000568351.1.47105 WP_000568351.1.47128 WP_000568351.1.47153 WP_000568351.1.47159 WP_000568351.1.47163 WP_000568351.1.47175 WP_000568351.1.47187 WP_000568351.1.47211 WP_000568351.1.47216 WP_000568351.1.47258 WP_000568351.1.47269 WP_000568351.1.47279 WP_000568351.1.4728 WP_000568351.1.47290 WP_000568351.1.47294 WP_000568351.1.47306 WP_000568351.1.47328 WP_000568351.1.47331 WP_000568351.1.47381 WP_000568351.1.47399 WP_000568351.1.47406 WP_000568351.1.47426 WP_000568351.1.47432 WP_000568351.1.47439 WP_000568351.1.47493 WP_000568351.1.47541 WP_000568351.1.47560 WP_000568351.1.47618 WP_000568351.1.47629 WP_000568351.1.4767 WP_000568351.1.477 WP_000568351.1.47702 WP_000568351.1.47733 WP_000568351.1.47782 WP_000568351.1.47835 WP_000568351.1.47836 WP_000568351.1.47859 WP_000568351.1.47864 WP_000568351.1.47872 WP_000568351.1.47873 WP_000568351.1.47904 WP_000568351.1.47996 WP_000568351.1.48011 WP_000568351.1.48030 WP_000568351.1.48047 WP_000568351.1.4805 WP_000568351.1.48057 WP_000568351.1.48149 WP_000568351.1.4815 WP_000568351.1.48154 WP_000568351.1.48169 WP_000568351.1.48186 WP_000568351.1.48205 WP_000568351.1.48227 WP_000568351.1.48236 WP_000568351.1.48250 WP_000568351.1.48284 WP_000568351.1.48293 WP_000568351.1.48307 WP_000568351.1.48322 WP_000568351.1.48335 WP_000568351.1.48391 WP_000568351.1.48394 WP_000568351.1.48463 WP_000568351.1.48563 WP_000568351.1.48577 WP_000568351.1.48593 WP_000568351.1.48634 WP_000568351.1.48655 WP_000568351.1.48656 WP_000568351.1.4868 WP_000568351.1.48705 WP_000568351.1.48711 WP_000568351.1.48805 WP_000568351.1.48817 WP_000568351.1.48823 WP_000568351.1.48833 WP_000568351.1.48835 WP_000568351.1.4886 WP_000568351.1.48936 WP_000568351.1.48941 WP_000568351.1.48945 WP_000568351.1.48951 WP_000568351.1.48968 WP_000568351.1.48982 WP_000568351.1.48993 WP_000568351.1.49032 WP_000568351.1.4905 WP_000568351.1.49128 WP_000568351.1.49129 WP_000568351.1.49159 WP_000568351.1.4916 WP_000568351.1.49161 WP_000568351.1.4917 WP_000568351.1.4918 WP_000568351.1.49207 WP_000568351.1.49248 WP_000568351.1.49327 WP_000568351.1.49398 WP_000568351.1.49444 WP_000568351.1.49479 WP_000568351.1.4950 WP_000568351.1.49539 WP_000568351.1.4962 WP_000568351.1.49653 WP_000568351.1.49669 WP_000568351.1.49730 WP_000568351.1.49742 WP_000568351.1.4980 WP_000568351.1.49800 WP_000568351.1.4984 WP_000568351.1.49863 WP_000568351.1.49871 WP_000568351.1.4989 WP_000568351.1.49894 WP_000568351.1.49907 WP_000568351.1.4994 WP_000568351.1.49970 WP_000568351.1.49982 WP_000568351.1.50013 WP_000568351.1.50038 WP_000568351.1.50039 WP_000568351.1.50061 WP_000568351.1.50076 WP_000568351.1.5013 WP_000568351.1.50138 WP_000568351.1.50217 WP_000568351.1.50219 WP_000568351.1.50261 WP_000568351.1.50313 WP_000568351.1.50314 WP_000568351.1.50356 WP_000568351.1.50377 WP_000568351.1.50425 WP_000568351.1.50430 WP_000568351.1.50477 WP_000568351.1.50536 WP_000568351.1.50555 WP_000568351.1.50556 WP_000568351.1.50578 WP_000568351.1.50595 WP_000568351.1.50660 WP_000568351.1.50768 WP_000568351.1.50799 WP_000568351.1.50820 WP_000568351.1.5087 WP_000568351.1.50884 WP_000568351.1.50896 WP_000568351.1.50937 WP_000568351.1.50962 WP_000568351.1.5108 WP_000568351.1.5109 WP_000568351.1.5110 WP_000568351.1.5111 WP_000568351.1.51152 WP_000568351.1.51220 WP_000568351.1.51236 WP_000568351.1.51245 WP_000568351.1.51250 WP_000568351.1.51282 WP_000568351.1.51295 WP_000568351.1.51306 WP_000568351.1.51310 WP_000568351.1.51346 WP_000568351.1.51365 WP_000568351.1.51376 WP_000568351.1.51403 WP_000568351.1.51454 WP_000568351.1.51456 WP_000568351.1.51492 WP_000568351.1.515 WP_000568351.1.51527 WP_000568351.1.5155 WP_000568351.1.51559 WP_000568351.1.51575 WP_000568351.1.51590 WP_000568351.1.51665 WP_000568351.1.51716 WP_000568351.1.51744 WP_000568351.1.51748 WP_000568351.1.51797 WP_000568351.1.51836 WP_000568351.1.51842 WP_000568351.1.51844 WP_000568351.1.5186 WP_000568351.1.51883 WP_000568351.1.51912 WP_000568351.1.51924 WP_000568351.1.51936 WP_000568351.1.51952 WP_000568351.1.51971 WP_000568351.1.52078 WP_000568351.1.521 WP_000568351.1.5213 WP_000568351.1.52151 WP_000568351.1.52182 WP_000568351.1.52185 WP_000568351.1.52193 WP_000568351.1.52224 WP_000568351.1.52251 WP_000568351.1.52296 WP_000568351.1.523 WP_000568351.1.52322 WP_000568351.1.52327 WP_000568351.1.52331 WP_000568351.1.52340 WP_000568351.1.52440 WP_000568351.1.52442 WP_000568351.1.52463 WP_000568351.1.52518 WP_000568351.1.52548 WP_000568351.1.52595 WP_000568351.1.52624 WP_000568351.1.52633 WP_000568351.1.52645 WP_000568351.1.52670 WP_000568351.1.52687 WP_000568351.1.52699 WP_000568351.1.52715 WP_000568351.1.52722 WP_000568351.1.52848 WP_000568351.1.52865 WP_000568351.1.52877 WP_000568351.1.52878 WP_000568351.1.52941 WP_000568351.1.52947 WP_000568351.1.52984 WP_000568351.1.53002 WP_000568351.1.53071 WP_000568351.1.53140 WP_000568351.1.53153 WP_000568351.1.53178 WP_000568351.1.53209 WP_000568351.1.53260 WP_000568351.1.53317 WP_000568351.1.53319 WP_000568351.1.53323 WP_000568351.1.53372 WP_000568351.1.53387 WP_000568351.1.53394 WP_000568351.1.53403 WP_000568351.1.53418 WP_000568351.1.53432 WP_000568351.1.53433 WP_000568351.1.53462 WP_000568351.1.53521 WP_000568351.1.53577 WP_000568351.1.53641 WP_000568351.1.53648 WP_000568351.1.53671 WP_000568351.1.53691 WP_000568351.1.53759 WP_000568351.1.53766 WP_000568351.1.53827 WP_000568351.1.53889 WP_000568351.1.53915 WP_000568351.1.53934 WP_000568351.1.53969 WP_000568351.1.53999 WP_000568351.1.5401 WP_000568351.1.54022 WP_000568351.1.54094 WP_000568351.1.54109 WP_000568351.1.54147 WP_000568351.1.54229 WP_000568351.1.54253 WP_000568351.1.54297 WP_000568351.1.54395 WP_000568351.1.544 WP_000568351.1.54413 WP_000568351.1.54446 WP_000568351.1.54491 WP_000568351.1.54503 WP_000568351.1.54510 WP_000568351.1.54543 WP_000568351.1.54551 WP_000568351.1.54637 WP_000568351.1.54675 WP_000568351.1.5469 WP_000568351.1.54745 WP_000568351.1.54753 WP_000568351.1.54878 WP_000568351.1.54955 WP_000568351.1.55014 WP_000568351.1.55058 WP_000568351.1.55100 WP_000568351.1.5519 WP_000568351.1.55214 WP_000568351.1.55274 WP_000568351.1.55309 WP_000568351.1.55367 WP_000568351.1.55369 WP_000568351.1.55403 WP_000568351.1.55405 WP_000568351.1.55421 WP_000568351.1.55508 WP_000568351.1.5554 WP_000568351.1.55544 WP_000568351.1.55558 WP_000568351.1.5556 WP_000568351.1.55583 WP_000568351.1.5559 WP_000568351.1.55628 WP_000568351.1.55637 WP_000568351.1.55653 WP_000568351.1.557 WP_000568351.1.55717 WP_000568351.1.55786 WP_000568351.1.5580 WP_000568351.1.55818 WP_000568351.1.55831 WP_000568351.1.55835 WP_000568351.1.55867 WP_000568351.1.55874 WP_000568351.1.55886 WP_000568351.1.5589 WP_000568351.1.55904 WP_000568351.1.55916 WP_000568351.1.55933 WP_000568351.1.55949 WP_000568351.1.55953 WP_000568351.1.55985 WP_000568351.1.56000 WP_000568351.1.56025 WP_000568351.1.56048 WP_000568351.1.56078 WP_000568351.1.56098 WP_000568351.1.56225 WP_000568351.1.5623 WP_000568351.1.56239 WP_000568351.1.56332 WP_000568351.1.56333 WP_000568351.1.5635 WP_000568351.1.5637 WP_000568351.1.56400 WP_000568351.1.5644 WP_000568351.1.56558 WP_000568351.1.5658 WP_000568351.1.56598 WP_000568351.1.566 WP_000568351.1.56628 WP_000568351.1.56641 WP_000568351.1.56658 WP_000568351.1.5666 WP_000568351.1.56767 WP_000568351.1.5677 WP_000568351.1.56778 WP_000568351.1.56794 WP_000568351.1.56815 WP_000568351.1.56856 WP_000568351.1.5686 WP_000568351.1.56865 WP_000568351.1.56878 WP_000568351.1.569 WP_000568351.1.56986 WP_000568351.1.57047 WP_000568351.1.57073 WP_000568351.1.57075 WP_000568351.1.57080 WP_000568351.1.57097 WP_000568351.1.57109 WP_000568351.1.57170 WP_000568351.1.5718 WP_000568351.1.57190 WP_000568351.1.57196 WP_000568351.1.57214 WP_000568351.1.57265 WP_000568351.1.57309 WP_000568351.1.57338 WP_000568351.1.57445 WP_000568351.1.57481 WP_000568351.1.5749 WP_000568351.1.57594 WP_000568351.1.57650 WP_000568351.1.57665 WP_000568351.1.57682 WP_000568351.1.57692 WP_000568351.1.57723 WP_000568351.1.57730 WP_000568351.1.57734 WP_000568351.1.57754 WP_000568351.1.57808 WP_000568351.1.57819 WP_000568351.1.57837 WP_000568351.1.57840 WP_000568351.1.57861 WP_000568351.1.57878 WP_000568351.1.5791 WP_000568351.1.57943 WP_000568351.1.57952 WP_000568351.1.57974 WP_000568351.1.58016 WP_000568351.1.58049 WP_000568351.1.58074 WP_000568351.1.58116 WP_000568351.1.58127 WP_000568351.1.58148 WP_000568351.1.58158 WP_000568351.1.5816 WP_000568351.1.58212 WP_000568351.1.58277 WP_000568351.1.58317 WP_000568351.1.58321 WP_000568351.1.58352 WP_000568351.1.58364 WP_000568351.1.58395 WP_000568351.1.58419 WP_000568351.1.58430 WP_000568351.1.58495 WP_000568351.1.58512 WP_000568351.1.58530 WP_000568351.1.58538 WP_000568351.1.5857 WP_000568351.1.58571 WP_000568351.1.58592 WP_000568351.1.58598 WP_000568351.1.58686 WP_000568351.1.58704 WP_000568351.1.58735 WP_000568351.1.58760 WP_000568351.1.58763 WP_000568351.1.58772 WP_000568351.1.5880 WP_000568351.1.58855 WP_000568351.1.58934 WP_000568351.1.58981 WP_000568351.1.59011 WP_000568351.1.59014 WP_000568351.1.59039 WP_000568351.1.59077 WP_000568351.1.59124 WP_000568351.1.59146 WP_000568351.1.59187 WP_000568351.1.5920 WP_000568351.1.59311 WP_000568351.1.59329 WP_000568351.1.59398 WP_000568351.1.5940 WP_000568351.1.59404 WP_000568351.1.59462 WP_000568351.1.59464 WP_000568351.1.59498 WP_000568351.1.59540 WP_000568351.1.59546 WP_000568351.1.59598 WP_000568351.1.59624 WP_000568351.1.59643 WP_000568351.1.59668 WP_000568351.1.59669 WP_000568351.1.59671 WP_000568351.1.5972 WP_000568351.1.59736 WP_000568351.1.59787 WP_000568351.1.59819 WP_000568351.1.5982 WP_000568351.1.59822 WP_000568351.1.59874 WP_000568351.1.59907 WP_000568351.1.59915 WP_000568351.1.60006 WP_000568351.1.6006 WP_000568351.1.6011 WP_000568351.1.60123 WP_000568351.1.60147 WP_000568351.1.60149 WP_000568351.1.60157 WP_000568351.1.6017 WP_000568351.1.60201 WP_000568351.1.60227 WP_000568351.1.60302 WP_000568351.1.60345 WP_000568351.1.60353 WP_000568351.1.60360 WP_000568351.1.60431 WP_000568351.1.60434 WP_000568351.1.60492 WP_000568351.1.60547 WP_000568351.1.60585 WP_000568351.1.60595 WP_000568351.1.60636 WP_000568351.1.60641 WP_000568351.1.60734 WP_000568351.1.60750 WP_000568351.1.60751 WP_000568351.1.60758 WP_000568351.1.60759 WP_000568351.1.60765 WP_000568351.1.60778 WP_000568351.1.60813 WP_000568351.1.60820 WP_000568351.1.60845 WP_000568351.1.6085 WP_000568351.1.60869 WP_000568351.1.60888 WP_000568351.1.60912 WP_000568351.1.60923 WP_000568351.1.60946 WP_000568351.1.60948 WP_000568351.1.60965 WP_000568351.1.60991 WP_000568351.1.61009 WP_000568351.1.61013 WP_000568351.1.61023 WP_000568351.1.61026 WP_000568351.1.61029 WP_000568351.1.61031 WP_000568351.1.61082 WP_000568351.1.61115 WP_000568351.1.61139 WP_000568351.1.61189 WP_000568351.1.6119 WP_000568351.1.61224 WP_000568351.1.6123 WP_000568351.1.61263 WP_000568351.1.61271 WP_000568351.1.61286 WP_000568351.1.61289 WP_000568351.1.61313 WP_000568351.1.61316 WP_000568351.1.61327 WP_000568351.1.6136 WP_000568351.1.61375 WP_000568351.1.61393 WP_000568351.1.61394 WP_000568351.1.61430 WP_000568351.1.61439 WP_000568351.1.61440 WP_000568351.1.61555 WP_000568351.1.61585 WP_000568351.1.61597 WP_000568351.1.61615 WP_000568351.1.61639 WP_000568351.1.6166 WP_000568351.1.61705 WP_000568351.1.61749 WP_000568351.1.61800 WP_000568351.1.61802 WP_000568351.1.61831 WP_000568351.1.61838 WP_000568351.1.61897 WP_000568351.1.619 WP_000568351.1.61903 WP_000568351.1.61936 WP_000568351.1.61978 WP_000568351.1.62002 WP_000568351.1.6201 WP_000568351.1.62028 WP_000568351.1.62069 WP_000568351.1.62071 WP_000568351.1.6208 WP_000568351.1.62096 WP_000568351.1.62247 WP_000568351.1.62254 WP_000568351.1.62318 WP_000568351.1.62346 WP_000568351.1.62352 WP_000568351.1.62382 WP_000568351.1.62398 WP_000568351.1.62429 WP_000568351.1.62437 WP_000568351.1.62453 WP_000568351.1.62474 WP_000568351.1.62496 WP_000568351.1.6250 WP_000568351.1.62553 WP_000568351.1.62602 WP_000568351.1.62630 WP_000568351.1.62653 WP_000568351.1.62671 WP_000568351.1.62674 WP_000568351.1.6268 WP_000568351.1.62684 WP_000568351.1.62723 WP_000568351.1.62764 WP_000568351.1.62771 WP_000568351.1.62822 WP_000568351.1.62824 WP_000568351.1.62831 WP_000568351.1.62863 WP_000568351.1.62880 WP_000568351.1.62970 WP_000568351.1.63003 WP_000568351.1.63004 WP_000568351.1.63027 WP_000568351.1.63052 WP_000568351.1.63068 WP_000568351.1.63070 WP_000568351.1.63083 WP_000568351.1.63139 WP_000568351.1.63140 WP_000568351.1.63215 WP_000568351.1.63220 WP_000568351.1.63266 WP_000568351.1.63289 WP_000568351.1.63304 WP_000568351.1.63313 WP_000568351.1.63322 WP_000568351.1.63333 WP_000568351.1.63341 WP_000568351.1.63441 WP_000568351.1.63469 WP_000568351.1.63471 WP_000568351.1.63589 WP_000568351.1.63673 WP_000568351.1.63678 WP_000568351.1.63726 WP_000568351.1.63729 WP_000568351.1.6374 WP_000568351.1.63751 WP_000568351.1.63759 WP_000568351.1.63774 WP_000568351.1.63828 WP_000568351.1.63874 WP_000568351.1.6388 WP_000568351.1.63895 WP_000568351.1.63907 WP_000568351.1.63975 WP_000568351.1.6403 WP_000568351.1.6408 WP_000568351.1.64192 WP_000568351.1.64250 WP_000568351.1.64304 WP_000568351.1.64367 WP_000568351.1.6438 WP_000568351.1.64400 WP_000568351.1.64440 WP_000568351.1.64456 WP_000568351.1.64457 WP_000568351.1.64473 WP_000568351.1.64525 WP_000568351.1.64565 WP_000568351.1.64583 WP_000568351.1.6459 WP_000568351.1.64598 WP_000568351.1.6462 WP_000568351.1.64677 WP_000568351.1.64686 WP_000568351.1.64720 WP_000568351.1.64765 WP_000568351.1.6479 WP_000568351.1.64858 WP_000568351.1.64879 WP_000568351.1.6488 WP_000568351.1.64893 WP_000568351.1.64897 WP_000568351.1.64928 WP_000568351.1.64935 WP_000568351.1.64961 WP_000568351.1.64994 WP_000568351.1.65033 WP_000568351.1.65044 WP_000568351.1.65046 WP_000568351.1.65132 WP_000568351.1.65158 WP_000568351.1.65180 WP_000568351.1.65193 WP_000568351.1.65203 WP_000568351.1.65217 WP_000568351.1.65243 WP_000568351.1.6531 WP_000568351.1.65317 WP_000568351.1.65367 WP_000568351.1.65419 WP_000568351.1.65423 WP_000568351.1.65443 WP_000568351.1.65451 WP_000568351.1.6547 WP_000568351.1.65504 WP_000568351.1.6551 WP_000568351.1.65520 WP_000568351.1.65544 WP_000568351.1.65562 WP_000568351.1.65600 WP_000568351.1.65675 WP_000568351.1.65689 WP_000568351.1.65693 WP_000568351.1.65700 WP_000568351.1.65703 WP_000568351.1.65705 WP_000568351.1.65856 WP_000568351.1.65922 WP_000568351.1.65931 WP_000568351.1.66009 WP_000568351.1.66081 WP_000568351.1.661 WP_000568351.1.6612 WP_000568351.1.66120 WP_000568351.1.66133 WP_000568351.1.66175 WP_000568351.1.66262 WP_000568351.1.66302 WP_000568351.1.66433 WP_000568351.1.66505 WP_000568351.1.66519 WP_000568351.1.66542 WP_000568351.1.66564 WP_000568351.1.66588 WP_000568351.1.66601 WP_000568351.1.66606 WP_000568351.1.6662 WP_000568351.1.66664 WP_000568351.1.66677 WP_000568351.1.66711 WP_000568351.1.66726 WP_000568351.1.6674 WP_000568351.1.66786 WP_000568351.1.66818 WP_000568351.1.6684 WP_000568351.1.66879 WP_000568351.1.6700 WP_000568351.1.67112 WP_000568351.1.67135 WP_000568351.1.67191 WP_000568351.1.6722 WP_000568351.1.67266 WP_000568351.1.67296 WP_000568351.1.67329 WP_000568351.1.67333 WP_000568351.1.67379 WP_000568351.1.6740 WP_000568351.1.67414 WP_000568351.1.67447 WP_000568351.1.67463 WP_000568351.1.67480 WP_000568351.1.67505 WP_000568351.1.67507 WP_000568351.1.67520 WP_000568351.1.67521 WP_000568351.1.67554 WP_000568351.1.67572 WP_000568351.1.67632 WP_000568351.1.67651 WP_000568351.1.67652 WP_000568351.1.67712 WP_000568351.1.67713 WP_000568351.1.67722 WP_000568351.1.67754 WP_000568351.1.67815 WP_000568351.1.6786 WP_000568351.1.67865 WP_000568351.1.67925 WP_000568351.1.67986 WP_000568351.1.68033 WP_000568351.1.68054 WP_000568351.1.68066 WP_000568351.1.6811 WP_000568351.1.68111 WP_000568351.1.68139 WP_000568351.1.68160 WP_000568351.1.68161 WP_000568351.1.68199 WP_000568351.1.68261 WP_000568351.1.68295 WP_000568351.1.68296 WP_000568351.1.6830 WP_000568351.1.68307 WP_000568351.1.6834 WP_000568351.1.68343 WP_000568351.1.68351 WP_000568351.1.68367 WP_000568351.1.6839 WP_000568351.1.68397 WP_000568351.1.68404 WP_000568351.1.68425 WP_000568351.1.68483 WP_000568351.1.68489 WP_000568351.1.68522 WP_000568351.1.68565 WP_000568351.1.68636 WP_000568351.1.68650 WP_000568351.1.68699 WP_000568351.1.68703 WP_000568351.1.68728 WP_000568351.1.68737 WP_000568351.1.68775 WP_000568351.1.68813 WP_000568351.1.68831 WP_000568351.1.68854 WP_000568351.1.68864 WP_000568351.1.68875 WP_000568351.1.68943 WP_000568351.1.68944 WP_000568351.1.69045 WP_000568351.1.69087 WP_000568351.1.69089 WP_000568351.1.691 WP_000568351.1.6917 WP_000568351.1.69179 WP_000568351.1.69191 WP_000568351.1.69219 WP_000568351.1.69222 WP_000568351.1.69237 WP_000568351.1.69239 WP_000568351.1.69251 WP_000568351.1.69366 WP_000568351.1.69395 WP_000568351.1.69415 WP_000568351.1.69434 WP_000568351.1.69476 WP_000568351.1.69480 WP_000568351.1.695 WP_000568351.1.6953 WP_000568351.1.69552 WP_000568351.1.69563 WP_000568351.1.69622 WP_000568351.1.69679 WP_000568351.1.69842 WP_000568351.1.69877 WP_000568351.1.69878 WP_000568351.1.69921 WP_000568351.1.69987 WP_000568351.1.70024 WP_000568351.1.70048 WP_000568351.1.70089 WP_000568351.1.70105 WP_000568351.1.7012 WP_000568351.1.70133 WP_000568351.1.70210 WP_000568351.1.7024 WP_000568351.1.70253 WP_000568351.1.70273 WP_000568351.1.7034 WP_000568351.1.70344 WP_000568351.1.70349 WP_000568351.1.70353 WP_000568351.1.7043 WP_000568351.1.70451 WP_000568351.1.70459 WP_000568351.1.70462 WP_000568351.1.7053 WP_000568351.1.70546 WP_000568351.1.7061 WP_000568351.1.70635 WP_000568351.1.70641 WP_000568351.1.7067 WP_000568351.1.7073 WP_000568351.1.70823 WP_000568351.1.70829 WP_000568351.1.70855 WP_000568351.1.70924 WP_000568351.1.70930 WP_000568351.1.70939 WP_000568351.1.70943 WP_000568351.1.71043 WP_000568351.1.71058 WP_000568351.1.71059 WP_000568351.1.71073 WP_000568351.1.7109 WP_000568351.1.71130 WP_000568351.1.71143 WP_000568351.1.71182 WP_000568351.1.71196 WP_000568351.1.7120 WP_000568351.1.71257 WP_000568351.1.71295 WP_000568351.1.71298 WP_000568351.1.71325 WP_000568351.1.71345 WP_000568351.1.71359 WP_000568351.1.71416 WP_000568351.1.71419 WP_000568351.1.71463 WP_000568351.1.71466 WP_000568351.1.7150 WP_000568351.1.71519 WP_000568351.1.71529 WP_000568351.1.71543 WP_000568351.1.71572 WP_000568351.1.71575 WP_000568351.1.7158 WP_000568351.1.71596 WP_000568351.1.71602 WP_000568351.1.7161 WP_000568351.1.71662 WP_000568351.1.71676 WP_000568351.1.71735 WP_000568351.1.7179 WP_000568351.1.71861 WP_000568351.1.71925 WP_000568351.1.71989 WP_000568351.1.72026 WP_000568351.1.72031 WP_000568351.1.72067 WP_000568351.1.72169 WP_000568351.1.72176 WP_000568351.1.72205 WP_000568351.1.72271 WP_000568351.1.72330 WP_000568351.1.72347 WP_000568351.1.7236 WP_000568351.1.72366 WP_000568351.1.72424 WP_000568351.1.72478 WP_000568351.1.72547 WP_000568351.1.72564 WP_000568351.1.72654 WP_000568351.1.72787 WP_000568351.1.72816 WP_000568351.1.72832 WP_000568351.1.72834 WP_000568351.1.72835 WP_000568351.1.72903 WP_000568351.1.72904 WP_000568351.1.72935 WP_000568351.1.72945 WP_000568351.1.73017 WP_000568351.1.73019 WP_000568351.1.73022 WP_000568351.1.73037 WP_000568351.1.73122 WP_000568351.1.73132 WP_000568351.1.73265 WP_000568351.1.73286 WP_000568351.1.73386 WP_000568351.1.73444 WP_000568351.1.73456 WP_000568351.1.73501 WP_000568351.1.73571 WP_000568351.1.73591 WP_000568351.1.736 WP_000568351.1.73639 WP_000568351.1.73685 WP_000568351.1.73735 WP_000568351.1.73759 WP_000568351.1.73786 WP_000568351.1.7380 WP_000568351.1.73834 WP_000568351.1.73858 WP_000568351.1.73868 WP_000568351.1.73910 WP_000568351.1.73920 WP_000568351.1.73961 WP_000568351.1.73969 WP_000568351.1.73976 WP_000568351.1.73983 WP_000568351.1.74006 WP_000568351.1.74010 WP_000568351.1.74027 WP_000568351.1.74081 WP_000568351.1.74155 WP_000568351.1.74157 WP_000568351.1.74161 WP_000568351.1.74172 WP_000568351.1.74173 WP_000568351.1.74183 WP_000568351.1.74216 WP_000568351.1.74234 WP_000568351.1.74237 WP_000568351.1.7427 WP_000568351.1.74273 WP_000568351.1.7434 WP_000568351.1.74353 WP_000568351.1.74356 WP_000568351.1.74380 WP_000568351.1.74429 WP_000568351.1.74457 WP_000568351.1.74533 WP_000568351.1.7457 WP_000568351.1.74587 WP_000568351.1.74610 WP_000568351.1.74638 WP_000568351.1.74696 WP_000568351.1.74704 WP_000568351.1.74731 WP_000568351.1.74747 WP_000568351.1.74761 WP_000568351.1.74802 WP_000568351.1.74840 WP_000568351.1.74846 WP_000568351.1.74866 WP_000568351.1.74890 WP_000568351.1.74911 WP_000568351.1.74922 WP_000568351.1.74924 WP_000568351.1.74961 WP_000568351.1.74994 WP_000568351.1.74999 WP_000568351.1.75038 WP_000568351.1.75044 WP_000568351.1.75048 WP_000568351.1.75052 WP_000568351.1.75093 WP_000568351.1.75141 WP_000568351.1.75186 WP_000568351.1.75227 WP_000568351.1.75252 WP_000568351.1.75253 WP_000568351.1.75294 WP_000568351.1.75298 WP_000568351.1.75320 WP_000568351.1.75327 WP_000568351.1.75349 WP_000568351.1.75365 WP_000568351.1.75399 WP_000568351.1.7542 WP_000568351.1.75438 WP_000568351.1.75440 WP_000568351.1.75527 WP_000568351.1.75551 WP_000568351.1.7561 WP_000568351.1.75649 WP_000568351.1.75652 WP_000568351.1.75685 WP_000568351.1.75769 WP_000568351.1.75775 WP_000568351.1.758 WP_000568351.1.75830 WP_000568351.1.75848 WP_000568351.1.75851 WP_000568351.1.75881 WP_000568351.1.75885 WP_000568351.1.75929 WP_000568351.1.75952 WP_000568351.1.75956 WP_000568351.1.7596 WP_000568351.1.75969 WP_000568351.1.76010 WP_000568351.1.76015 WP_000568351.1.76095 WP_000568351.1.76143 WP_000568351.1.76149 WP_000568351.1.76230 WP_000568351.1.76234 WP_000568351.1.7624 WP_000568351.1.7625 WP_000568351.1.76258 WP_000568351.1.76261 WP_000568351.1.76294 WP_000568351.1.76332 WP_000568351.1.76337 WP_000568351.1.76351 WP_000568351.1.76419 WP_000568351.1.76420 WP_000568351.1.76421 WP_000568351.1.76482 WP_000568351.1.7658 WP_000568351.1.76606 WP_000568351.1.76624 WP_000568351.1.76648 WP_000568351.1.76686 WP_000568351.1.76690 WP_000568351.1.76693 WP_000568351.1.7675 WP_000568351.1.76790 WP_000568351.1.76792 WP_000568351.1.768 WP_000568351.1.76816 WP_000568351.1.76820 WP_000568351.1.76825 WP_000568351.1.76839 WP_000568351.1.76845 WP_000568351.1.76897 WP_000568351.1.76921 WP_000568351.1.76944 WP_000568351.1.76952 WP_000568351.1.76998 WP_000568351.1.77031 WP_000568351.1.77041 WP_000568351.1.77050 WP_000568351.1.77060 WP_000568351.1.77062 WP_000568351.1.77112 WP_000568351.1.77145 WP_000568351.1.77305 WP_000568351.1.7745 WP_000568351.1.7746 WP_000568351.1.77460 WP_000568351.1.77485 WP_000568351.1.77489 WP_000568351.1.77497 WP_000568351.1.7752 WP_000568351.1.77520 WP_000568351.1.77527 WP_000568351.1.77533 WP_000568351.1.77536 WP_000568351.1.77572 WP_000568351.1.77603 WP_000568351.1.77606 WP_000568351.1.77733 WP_000568351.1.77738 WP_000568351.1.7774 WP_000568351.1.77743 WP_000568351.1.77818 WP_000568351.1.77822 WP_000568351.1.77848 WP_000568351.1.77858 WP_000568351.1.7787 WP_000568351.1.77957 WP_000568351.1.78054 WP_000568351.1.78091 WP_000568351.1.7810 WP_000568351.1.78173 WP_000568351.1.78189 WP_000568351.1.78207 WP_000568351.1.78208 WP_000568351.1.78252 WP_000568351.1.78254 WP_000568351.1.78257 WP_000568351.1.7827 WP_000568351.1.78311 WP_000568351.1.7833 WP_000568351.1.78332 WP_000568351.1.78365 WP_000568351.1.78392 WP_000568351.1.7850 WP_000568351.1.78513 WP_000568351.1.78558 WP_000568351.1.7857 WP_000568351.1.78598 WP_000568351.1.78604 WP_000568351.1.78653 WP_000568351.1.78667 WP_000568351.1.7868 WP_000568351.1.78728 WP_000568351.1.78731 WP_000568351.1.78803 WP_000568351.1.78819 WP_000568351.1.78841 WP_000568351.1.78897 WP_000568351.1.78946 WP_000568351.1.78983 WP_000568351.1.78985 WP_000568351.1.7900 WP_000568351.1.79006 WP_000568351.1.79038 WP_000568351.1.79051 WP_000568351.1.79085 WP_000568351.1.79131 WP_000568351.1.79170 WP_000568351.1.79197 WP_000568351.1.79208 WP_000568351.1.79223 WP_000568351.1.79270 WP_000568351.1.7931 WP_000568351.1.79310 WP_000568351.1.79314 WP_000568351.1.79322 WP_000568351.1.79332 WP_000568351.1.7934 WP_000568351.1.79367 WP_000568351.1.79374 WP_000568351.1.79379 WP_000568351.1.79402 WP_000568351.1.79436 WP_000568351.1.79461 WP_000568351.1.79476 WP_000568351.1.79487 WP_000568351.1.79539 WP_000568351.1.79556 WP_000568351.1.79626 WP_000568351.1.79638 WP_000568351.1.79662 WP_000568351.1.79664 WP_000568351.1.79672 WP_000568351.1.79706 WP_000568351.1.79822 WP_000568351.1.79831 WP_000568351.1.79834 WP_000568351.1.79837 WP_000568351.1.7989 WP_000568351.1.79896 WP_000568351.1.79911 WP_000568351.1.7992 WP_000568351.1.79941 WP_000568351.1.79961 WP_000568351.1.79971 WP_000568351.1.79991 WP_000568351.1.80000 WP_000568351.1.80032 WP_000568351.1.80042 WP_000568351.1.80079 WP_000568351.1.80109 WP_000568351.1.80127 WP_000568351.1.80203 WP_000568351.1.80206 WP_000568351.1.80287 WP_000568351.1.80290 WP_000568351.1.80297 WP_000568351.1.8031 WP_000568351.1.8035 WP_000568351.1.80358 WP_000568351.1.80378 WP_000568351.1.8043 WP_000568351.1.80472 WP_000568351.1.80530 WP_000568351.1.8065 WP_000568351.1.80687 WP_000568351.1.80717 WP_000568351.1.80761 WP_000568351.1.80763 WP_000568351.1.80781 WP_000568351.1.80786 WP_000568351.1.80833 WP_000568351.1.8084 WP_000568351.1.80855 WP_000568351.1.80872 WP_000568351.1.80962 WP_000568351.1.81010 WP_000568351.1.81065 WP_000568351.1.81085 WP_000568351.1.81097 WP_000568351.1.81114 WP_000568351.1.81157 WP_000568351.1.81171 WP_000568351.1.81234 WP_000568351.1.8125 WP_000568351.1.81252 WP_000568351.1.8135 WP_000568351.1.81384 WP_000568351.1.81385 WP_000568351.1.81389 WP_000568351.1.8142 WP_000568351.1.8144 WP_000568351.1.81464 WP_000568351.1.81467 WP_000568351.1.81599 WP_000568351.1.81610 WP_000568351.1.81718 WP_000568351.1.81740 WP_000568351.1.81758 WP_000568351.1.81767 WP_000568351.1.81800 WP_000568351.1.81810 WP_000568351.1.81812 WP_000568351.1.81831 WP_000568351.1.81861 WP_000568351.1.81870 WP_000568351.1.81897 WP_000568351.1.81903 WP_000568351.1.81905 WP_000568351.1.81906 WP_000568351.1.81919 WP_000568351.1.81944 WP_000568351.1.81955 WP_000568351.1.81999 WP_000568351.1.82009 WP_000568351.1.82053 WP_000568351.1.82121 WP_000568351.1.82219 WP_000568351.1.82247 WP_000568351.1.82259 WP_000568351.1.82340 WP_000568351.1.82354 WP_000568351.1.82358 WP_000568351.1.82368 WP_000568351.1.82441 WP_000568351.1.82447 WP_000568351.1.8246 WP_000568351.1.82467 WP_000568351.1.82548 WP_000568351.1.82612 WP_000568351.1.8265 WP_000568351.1.82709 WP_000568351.1.82724 WP_000568351.1.82775 WP_000568351.1.82796 WP_000568351.1.8280 WP_000568351.1.82802 WP_000568351.1.82829 WP_000568351.1.82862 WP_000568351.1.8289 WP_000568351.1.82976 WP_000568351.1.82980 WP_000568351.1.83066 WP_000568351.1.8310 WP_000568351.1.83152 WP_000568351.1.83153 WP_000568351.1.83185 WP_000568351.1.83193 WP_000568351.1.83234 WP_000568351.1.8328 WP_000568351.1.83316 WP_000568351.1.83352 WP_000568351.1.83372 WP_000568351.1.83418 WP_000568351.1.83468 WP_000568351.1.83476 WP_000568351.1.83484 WP_000568351.1.83517 WP_000568351.1.83593 WP_000568351.1.83624 WP_000568351.1.83646 WP_000568351.1.83652 WP_000568351.1.83653 WP_000568351.1.83676 WP_000568351.1.83720 WP_000568351.1.83763 WP_000568351.1.83769 WP_000568351.1.83770 WP_000568351.1.83804 WP_000568351.1.83825 WP_000568351.1.8383 WP_000568351.1.83864 WP_000568351.1.83865 WP_000568351.1.83868 WP_000568351.1.83881 WP_000568351.1.83905 WP_000568351.1.83912 WP_000568351.1.83919 WP_000568351.1.83928 WP_000568351.1.83955 WP_000568351.1.83984 WP_000568351.1.84010 WP_000568351.1.84049 WP_000568351.1.84144 WP_000568351.1.84163 WP_000568351.1.84293 WP_000568351.1.84342 WP_000568351.1.84414 WP_000568351.1.84442 WP_000568351.1.84445 WP_000568351.1.84451 WP_000568351.1.84509 WP_000568351.1.84563 WP_000568351.1.84578 WP_000568351.1.84625 WP_000568351.1.84638 WP_000568351.1.8468 WP_000568351.1.84682 WP_000568351.1.8475 WP_000568351.1.84752 WP_000568351.1.84757 WP_000568351.1.84761 WP_000568351.1.84815 WP_000568351.1.84889 WP_000568351.1.84903 WP_000568351.1.84907 WP_000568351.1.84922 WP_000568351.1.8493 WP_000568351.1.84943 WP_000568351.1.85022 WP_000568351.1.85047 WP_000568351.1.85056 WP_000568351.1.85081 WP_000568351.1.85099 WP_000568351.1.85132 WP_000568351.1.85135 WP_000568351.1.85144 WP_000568351.1.85151 WP_000568351.1.85160 WP_000568351.1.85213 WP_000568351.1.85226 WP_000568351.1.85231 WP_000568351.1.85235 WP_000568351.1.85238 WP_000568351.1.85292 WP_000568351.1.85351 WP_000568351.1.85395 WP_000568351.1.85404 WP_000568351.1.85445 WP_000568351.1.85462 WP_000568351.1.85471 WP_000568351.1.85474 WP_000568351.1.85492 WP_000568351.1.85506 WP_000568351.1.85515 WP_000568351.1.85519 WP_000568351.1.85547 WP_000568351.1.85555 WP_000568351.1.85586 WP_000568351.1.85596 WP_000568351.1.85649 WP_000568351.1.85758 WP_000568351.1.85795 WP_000568351.1.85796 WP_000568351.1.85816 WP_000568351.1.85834 WP_000568351.1.85873 WP_000568351.1.85927 WP_000568351.1.85950 WP_000568351.1.85989 WP_000568351.1.85993 WP_000568351.1.86018 WP_000568351.1.86072 WP_000568351.1.86144 WP_000568351.1.86154 WP_000568351.1.86158 WP_000568351.1.86188 WP_000568351.1.86207 WP_000568351.1.8627 WP_000568351.1.86270 WP_000568351.1.86304 WP_000568351.1.86344 WP_000568351.1.86367 WP_000568351.1.86378 WP_000568351.1.8643 WP_000568351.1.86439 WP_000568351.1.86482 WP_000568351.1.86523 WP_000568351.1.86542 WP_000568351.1.86628 WP_000568351.1.86706 WP_000568351.1.86792 WP_000568351.1.86838 WP_000568351.1.86881 WP_000568351.1.86911 WP_000568351.1.86940 WP_000568351.1.86942 WP_000568351.1.86961 WP_000568351.1.86977 WP_000568351.1.87021 WP_000568351.1.87042 WP_000568351.1.87057 WP_000568351.1.87072 WP_000568351.1.87090 WP_000568351.1.87119 WP_000568351.1.8712 WP_000568351.1.87122 WP_000568351.1.87141 WP_000568351.1.87175 WP_000568351.1.87194 WP_000568351.1.8720 WP_000568351.1.87260 WP_000568351.1.87261 WP_000568351.1.87272 WP_000568351.1.87285 WP_000568351.1.87290 WP_000568351.1.8731 WP_000568351.1.87396 WP_000568351.1.87457 WP_000568351.1.87461 WP_000568351.1.87466 WP_000568351.1.875 WP_000568351.1.87508 WP_000568351.1.87515 WP_000568351.1.8753 WP_000568351.1.87543 WP_000568351.1.87710 WP_000568351.1.87718 WP_000568351.1.87748 WP_000568351.1.87764 WP_000568351.1.87782 WP_000568351.1.8779 WP_000568351.1.87808 WP_000568351.1.87828 WP_000568351.1.87838 WP_000568351.1.87879 WP_000568351.1.8791 WP_000568351.1.87912 WP_000568351.1.87948 WP_000568351.1.87963 WP_000568351.1.87964 WP_000568351.1.87972 WP_000568351.1.87995 WP_000568351.1.88013 WP_000568351.1.88032 WP_000568351.1.88061 WP_000568351.1.88114 WP_000568351.1.88150 WP_000568351.1.88270 WP_000568351.1.88311 WP_000568351.1.88317 WP_000568351.1.88319 WP_000568351.1.88351 WP_000568351.1.88367 WP_000568351.1.88371 WP_000568351.1.88380 WP_000568351.1.88473 WP_000568351.1.88480 WP_000568351.1.88498 WP_000568351.1.88518 WP_000568351.1.88555 WP_000568351.1.88558 WP_000568351.1.88560 WP_000568351.1.8857 WP_000568351.1.88580 WP_000568351.1.88583 WP_000568351.1.88599 WP_000568351.1.88623 WP_000568351.1.88636 WP_000568351.1.88642 WP_000568351.1.88671 WP_000568351.1.88694 WP_000568351.1.8872 WP_000568351.1.88739 WP_000568351.1.88753 WP_000568351.1.88761 WP_000568351.1.88856 WP_000568351.1.88859 WP_000568351.1.8886 WP_000568351.1.8888 WP_000568351.1.88897 WP_000568351.1.88922 WP_000568351.1.88934 WP_000568351.1.88987 WP_000568351.1.8899 WP_000568351.1.8900 WP_000568351.1.89086 WP_000568351.1.8913 WP_000568351.1.89133 WP_000568351.1.89181 WP_000568351.1.89194 WP_000568351.1.89195 WP_000568351.1.89204 WP_000568351.1.8924 WP_000568351.1.89258 WP_000568351.1.89284 WP_000568351.1.89516 WP_000568351.1.89537 WP_000568351.1.89544 WP_000568351.1.89545 WP_000568351.1.89559 WP_000568351.1.89655 WP_000568351.1.89672 WP_000568351.1.89678 WP_000568351.1.89726 WP_000568351.1.89730 WP_000568351.1.89754 WP_000568351.1.89857 WP_000568351.1.8986 WP_000568351.1.89883 WP_000568351.1.89935 WP_000568351.1.89960 WP_000568351.1.90005 WP_000568351.1.90018 WP_000568351.1.90038 WP_000568351.1.90046 WP_000568351.1.90055 WP_000568351.1.90091 WP_000568351.1.90131 WP_000568351.1.90148 WP_000568351.1.90161 WP_000568351.1.90180 WP_000568351.1.90215 WP_000568351.1.9022 WP_000568351.1.90243 WP_000568351.1.90253 WP_000568351.1.90276 WP_000568351.1.9030 WP_000568351.1.90307 WP_000568351.1.90331 WP_000568351.1.90367 WP_000568351.1.90473 WP_000568351.1.90517 WP_000568351.1.90544 WP_000568351.1.9055 WP_000568351.1.90554 WP_000568351.1.90604 WP_000568351.1.90647 WP_000568351.1.90660 WP_000568351.1.90683 WP_000568351.1.9071 WP_000568351.1.90726 WP_000568351.1.90728 WP_000568351.1.90738 WP_000568351.1.90745 WP_000568351.1.90801 WP_000568351.1.90804 WP_000568351.1.90861 WP_000568351.1.90896 WP_000568351.1.90903 WP_000568351.1.90923 WP_000568351.1.9100 WP_000568351.1.91011 WP_000568351.1.91054 WP_000568351.1.91124 WP_000568351.1.91126 WP_000568351.1.9114 WP_000568351.1.91158 WP_000568351.1.91177 WP_000568351.1.912 WP_000568351.1.91233 WP_000568351.1.91246 WP_000568351.1.91258 WP_000568351.1.91279 WP_000568351.1.91300 WP_000568351.1.91332 WP_000568351.1.91346 WP_000568351.1.91357 WP_000568351.1.91364 WP_000568351.1.91382 WP_000568351.1.9140 WP_000568351.1.91420 WP_000568351.1.91427 WP_000568351.1.91487 WP_000568351.1.91500 WP_000568351.1.91559 WP_000568351.1.91573 WP_000568351.1.91581 WP_000568351.1.91587 WP_000568351.1.91639 WP_000568351.1.91749 WP_000568351.1.91771 WP_000568351.1.91791 WP_000568351.1.91800 WP_000568351.1.91816 WP_000568351.1.91829 WP_000568351.1.91895 WP_000568351.1.91928 WP_000568351.1.91950 WP_000568351.1.92 WP_000568351.1.92055 WP_000568351.1.92080 WP_000568351.1.92115 WP_000568351.1.92133 WP_000568351.1.92140 WP_000568351.1.92143 WP_000568351.1.92164 WP_000568351.1.92169 WP_000568351.1.92173 WP_000568351.1.92185 WP_000568351.1.92196 WP_000568351.1.92227 WP_000568351.1.9224 WP_000568351.1.92253 WP_000568351.1.92254 WP_000568351.1.92297 WP_000568351.1.923 WP_000568351.1.9234 WP_000568351.1.92340 WP_000568351.1.9239 WP_000568351.1.92436 WP_000568351.1.92442 WP_000568351.1.92479 WP_000568351.1.92488 WP_000568351.1.92497 WP_000568351.1.92500 WP_000568351.1.92520 WP_000568351.1.92534 WP_000568351.1.92541 WP_000568351.1.92565 WP_000568351.1.92602 WP_000568351.1.92607 WP_000568351.1.92679 WP_000568351.1.92691 WP_000568351.1.92723 WP_000568351.1.92735 WP_000568351.1.92741 WP_000568351.1.92773 WP_000568351.1.92789 WP_000568351.1.92805 WP_000568351.1.92862 WP_000568351.1.92864 WP_000568351.1.92918 WP_000568351.1.9293 WP_000568351.1.92937 WP_000568351.1.92950 WP_000568351.1.92960 WP_000568351.1.93074 WP_000568351.1.93125 WP_000568351.1.93163 WP_000568351.1.93176 WP_000568351.1.93191 WP_000568351.1.93224 WP_000568351.1.93231 WP_000568351.1.93235 WP_000568351.1.93237 WP_000568351.1.93272 WP_000568351.1.93296 WP_000568351.1.93300 WP_000568351.1.93416 WP_000568351.1.93438 WP_000568351.1.93444 WP_000568351.1.93514 WP_000568351.1.9352 WP_000568351.1.9354 WP_000568351.1.9358 WP_000568351.1.93590 WP_000568351.1.93658 WP_000568351.1.93678 WP_000568351.1.93710 WP_000568351.1.93722 WP_000568351.1.93736 WP_000568351.1.93738 WP_000568351.1.93769 WP_000568351.1.93787 WP_000568351.1.9387 WP_000568351.1.93882 WP_000568351.1.93883 WP_000568351.1.93891 WP_000568351.1.93976 WP_000568351.1.9398 WP_000568351.1.93981 WP_000568351.1.94074 WP_000568351.1.9408 WP_000568351.1.94082 WP_000568351.1.94087 WP_000568351.1.94096 WP_000568351.1.94119 WP_000568351.1.94165 WP_000568351.1.94172 WP_000568351.1.94293 WP_000568351.1.94294 WP_000568351.1.94335 WP_000568351.1.94340 WP_000568351.1.9437 WP_000568351.1.94374 WP_000568351.1.94375 WP_000568351.1.94376 WP_000568351.1.94389 WP_000568351.1.94414 WP_000568351.1.94423 WP_000568351.1.94530 WP_000568351.1.94550 WP_000568351.1.94576 WP_000568351.1.94688 WP_000568351.1.94733 WP_000568351.1.94741 WP_000568351.1.94789 WP_000568351.1.94797 WP_000568351.1.94844 WP_000568351.1.94845 WP_000568351.1.9485 WP_000568351.1.94857 WP_000568351.1.94866 WP_000568351.1.9497 WP_000568351.1.94980 WP_000568351.1.94989 WP_000568351.1.94999 WP_000568351.1.95038 WP_000568351.1.95075 WP_000568351.1.95077 WP_000568351.1.9510 WP_000568351.1.95120 WP_000568351.1.95318 WP_000568351.1.95327 WP_000568351.1.95342 WP_000568351.1.95361 WP_000568351.1.95372 WP_000568351.1.9538 WP_000568351.1.9544 WP_000568351.1.95476 WP_000568351.1.95537 WP_000568351.1.95550 WP_000568351.1.95571 WP_000568351.1.95581 WP_000568351.1.95603 WP_000568351.1.95639 WP_000568351.1.95681 WP_000568351.1.95699 WP_000568351.1.95704 WP_000568351.1.95713 WP_000568351.1.95714 WP_000568351.1.95737 WP_000568351.1.95877 WP_000568351.1.95885 WP_000568351.1.95914 WP_000568351.1.95918 WP_000568351.1.95986 WP_000568351.1.95997 WP_000568351.1.96014 WP_000568351.1.96022 WP_000568351.1.96030 WP_000568351.1.96056 WP_000568351.1.96057 WP_000568351.1.96067 WP_000568351.1.96075 WP_000568351.1.96135 WP_000568351.1.96148 WP_000568351.1.9617 WP_000568351.1.96228 WP_000568351.1.96255 WP_000568351.1.96283 WP_000568351.1.96297 WP_000568351.1.96312 WP_000568351.1.96314 WP_000568351.1.96322 WP_000568351.1.96334 WP_000568351.1.96362 WP_000568351.1.96433 WP_000568351.1.96472 WP_000568351.1.96474 WP_000568351.1.9650 WP_000568351.1.96535 WP_000568351.1.96538 WP_000568351.1.96554 WP_000568351.1.96566 WP_000568351.1.96591 WP_000568351.1.96603 WP_000568351.1.96678 WP_000568351.1.96682 WP_000568351.1.96699 WP_000568351.1.96705 WP_000568351.1.9675 WP_000568351.1.96780 WP_000568351.1.96836 WP_000568351.1.96854 WP_000568351.1.96855 WP_000568351.1.96859 WP_000568351.1.96882 WP_000568351.1.96922 WP_000568351.1.96965 WP_000568351.1.96969 WP_000568351.1.96985 WP_000568351.1.96997 WP_000568351.1.97000 WP_000568351.1.97004 WP_000568351.1.97014 WP_000568351.1.97017 WP_000568351.1.97019 WP_000568351.1.97029 WP_000568351.1.97034 WP_000568351.1.97141 WP_000568351.1.97161 WP_000568351.1.97164 WP_000568351.1.97205 WP_000568351.1.97228 WP_000568351.1.97230 WP_000568351.1.97241 WP_000568351.1.97312 WP_000568351.1.97336 WP_000568351.1.97348 WP_000568351.1.97352 WP_000568351.1.97355 WP_000568351.1.97367 WP_000568351.1.9737 WP_000568351.1.97392 WP_000568351.1.97427 WP_000568351.1.9743 WP_000568351.1.97444 WP_000568351.1.97450 WP_000568351.1.97456 WP_000568351.1.97466 WP_000568351.1.97484 WP_000568351.1.97494 WP_000568351.1.97530 WP_000568351.1.97531 WP_000568351.1.97537 WP_000568351.1.97576 WP_000568351.1.97585 WP_000568351.1.97664 WP_000568351.1.97687 WP_000568351.1.97696 WP_000568351.1.97699 WP_000568351.1.97717 WP_000568351.1.97720 WP_000568351.1.97744 WP_000568351.1.97746 WP_000568351.1.97762 WP_000568351.1.9788 WP_000568351.1.97935 WP_000568351.1.97955 WP_000568351.1.97967 WP_000568351.1.97974 WP_000568351.1.97997 WP_000568351.1.98054 WP_000568351.1.98058 WP_000568351.1.98073 WP_000568351.1.98161 WP_000568351.1.98174 WP_000568351.1.98179 WP_000568351.1.98191 WP_000568351.1.98195 WP_000568351.1.98233 WP_000568351.1.98248 WP_000568351.1.98249 WP_000568351.1.98281 WP_000568351.1.98295 WP_000568351.1.98328 WP_000568351.1.98352 WP_000568351.1.98353 WP_000568351.1.98366 WP_000568351.1.98387 WP_000568351.1.98409 WP_000568351.1.98425 WP_000568351.1.98497 WP_000568351.1.98585 WP_000568351.1.98609 WP_000568351.1.98659 WP_000568351.1.98667 WP_000568351.1.9872 WP_000568351.1.98723 WP_000568351.1.98730 WP_000568351.1.98734 WP_000568351.1.98741 WP_000568351.1.98750 WP_000568351.1.98786 WP_000568351.1.98797 WP_000568351.1.98821 WP_000568351.1.98842 WP_000568351.1.98880 WP_000568351.1.98883 WP_000568351.1.98894 WP_000568351.1.98978 WP_000568351.1.98985 WP_000568351.1.9903 WP_000568351.1.9910 WP_000568351.1.99136 WP_000568351.1.99207 WP_000568351.1.99217 WP_000568351.1.99237 WP_000568351.1.99283 WP_000568351.1.99308 WP_000568351.1.99311 WP_000568351.1.99414 WP_000568351.1.99418 WP_000568351.1.99509 WP_000568351.1.99523 WP_000568351.1.9965 WP_000568351.1.99830 WP_000568351.1.99849 WP_000568351.1.99859 WP_000568351.1.99884 WP_000568351.1.99954 WP_000568351.1.99955 WP_000568351.1.99984 WP_000568351.1.99999 gi|21283199|ref|NP_646287.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]