SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|537442891|ref|YP_008485468.1| from Staphylococcus aureus subsp. aureus 6850

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|537442891|ref|YP_008485468.1|
Domain Number 1 Region: 9-214
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.2e-55
Family G proteins 0.00026
Further Details:      
 
Domain Number 2 Region: 175-297
Classification Level Classification E-value
Superfamily Translation proteins 3.33e-33
Family Elongation factors 0.0028
Further Details:      
 
Domain Number 3 Region: 408-503
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.93e-26
Family EF-G/eEF-2 domains III and V 0.0082
Further Details:      
 
Domain Number 4 Region: 301-379
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 9.35e-18
Family EF-G/eEF-2 domains III and V 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|537442891|ref|YP_008485468.1|
Sequence length 607
Comment GTP-binding protein LepA [Staphylococcus aureus subsp. aureus 6850]
Sequence
MDNEQRLKRRENIRNFSIIAHIDHGKSTLADRILENTKSVETRDMQDQLLDSMDLERERG
ITIKLNAVRLKYEAKDGNTYTFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQ
TLANVYLALDNELELLPVINKIDLPAAEPERVKQEIEDMIGLDQDDVVLASAKSNIGIEE
ILEKIVEVVPAPDGDPEAPLKALIFDSEYDPYRGVISSIRIVDGVVKAGDKIRMMATGKE
FEVTEVGINTPKQLPVDELTVGDVGYIIASIKNVDDSRVGDTITLASRPASEPLQGYKKM
NPMVYCGLFPIDNKNYNDLREALEKLQLNDASLEFEPESSQALGFGYRTGFLGMLHMEII
QERIEREFGIELIATAPSVIYQCILRDGSEVTVDNPAQMPDRDKIDKIFEPYVRATMMVP
NDYVGAVMELCQRKRGQFINMDYLDDIRVNIVYELPLAEVVFDFFDQLKSNTKGYASFDY
EFIENKESNLVKMDILLNGDKVDALSFIVHRDFAYERGKALVEKLKTLIPRQQFEVPVQA
AIGQKIVARTNIKSMGKNVLAKCYGGDISRKRKLLEKQKAGKAKMKAVGNVEIPQDAFLA
VLKMDDE
Download sequence
Identical sequences A0A0D1I1Z9 A0A0E0VQN5 A0A0E1X4V0 A0A2H5AP70 A5ITB2 A6U257 A7X2Y7 P65271 P65272 Q2YT42 Q6G8Y3 Q6GGB6 T1Y9B8 W8UAD5
gi|49486419|ref|YP_043640.1| gi|537461280|ref|YP_008491720.1| gi|387602925|ref|YP_005734446.1| gi|15927165|ref|NP_374698.1| gi|404478935|ref|YP_006710365.1| WP_000368338.1.100075 WP_000368338.1.100084 WP_000368338.1.100096 WP_000368338.1.100117 WP_000368338.1.10014 WP_000368338.1.100171 WP_000368338.1.100184 WP_000368338.1.100235 WP_000368338.1.100265 WP_000368338.1.100272 WP_000368338.1.10032 WP_000368338.1.100335 WP_000368338.1.100347 WP_000368338.1.100357 WP_000368338.1.100366 WP_000368338.1.100384 WP_000368338.1.100399 WP_000368338.1.100452 WP_000368338.1.10046 WP_000368338.1.100464 WP_000368338.1.10050 WP_000368338.1.100507 WP_000368338.1.100527 WP_000368338.1.10053 WP_000368338.1.100534 WP_000368338.1.100535 WP_000368338.1.100560 WP_000368338.1.100562 WP_000368338.1.100596 WP_000368338.1.100604 WP_000368338.1.100612 WP_000368338.1.100613 WP_000368338.1.100665 WP_000368338.1.100668 WP_000368338.1.100678 WP_000368338.1.100693 WP_000368338.1.100699 WP_000368338.1.100704 WP_000368338.1.100719 WP_000368338.1.100726 WP_000368338.1.100785 WP_000368338.1.100823 WP_000368338.1.100832 WP_000368338.1.10085 WP_000368338.1.100860 WP_000368338.1.100888 WP_000368338.1.1009 WP_000368338.1.100934 WP_000368338.1.100956 WP_000368338.1.10097 WP_000368338.1.100986 WP_000368338.1.101002 WP_000368338.1.101019 WP_000368338.1.101023 WP_000368338.1.101027 WP_000368338.1.101055 WP_000368338.1.101068 WP_000368338.1.101071 WP_000368338.1.101072 WP_000368338.1.101103 WP_000368338.1.10111 WP_000368338.1.101142 WP_000368338.1.101160 WP_000368338.1.101192 WP_000368338.1.101217 WP_000368338.1.101262 WP_000368338.1.101330 WP_000368338.1.101352 WP_000368338.1.101355 WP_000368338.1.101379 WP_000368338.1.101397 WP_000368338.1.101402 WP_000368338.1.101406 WP_000368338.1.101414 WP_000368338.1.101440 WP_000368338.1.101441 WP_000368338.1.101458 WP_000368338.1.10148 WP_000368338.1.101495 WP_000368338.1.1015 WP_000368338.1.101511 WP_000368338.1.101531 WP_000368338.1.101567 WP_000368338.1.101598 WP_000368338.1.101617 WP_000368338.1.101619 WP_000368338.1.101627 WP_000368338.1.101645 WP_000368338.1.10165 WP_000368338.1.101657 WP_000368338.1.101661 WP_000368338.1.101670 WP_000368338.1.101691 WP_000368338.1.101704 WP_000368338.1.101716 WP_000368338.1.101728 WP_000368338.1.101731 WP_000368338.1.101745 WP_000368338.1.101758 WP_000368338.1.101775 WP_000368338.1.101778 WP_000368338.1.101779 WP_000368338.1.101813 WP_000368338.1.101820 WP_000368338.1.101821 WP_000368338.1.101824 WP_000368338.1.101825 WP_000368338.1.101831 WP_000368338.1.101852 WP_000368338.1.101902 WP_000368338.1.101906 WP_000368338.1.101921 WP_000368338.1.101922 WP_000368338.1.101943 WP_000368338.1.101999 WP_000368338.1.102065 WP_000368338.1.102084 WP_000368338.1.10209 WP_000368338.1.102096 WP_000368338.1.102123 WP_000368338.1.102126 WP_000368338.1.102130 WP_000368338.1.102132 WP_000368338.1.10214 WP_000368338.1.10238 WP_000368338.1.10240 WP_000368338.1.10244 WP_000368338.1.10249 WP_000368338.1.1025 WP_000368338.1.10292 WP_000368338.1.10294 WP_000368338.1.10301 WP_000368338.1.10306 WP_000368338.1.10308 WP_000368338.1.1031 WP_000368338.1.1032 WP_000368338.1.10321 WP_000368338.1.10343 WP_000368338.1.10355 WP_000368338.1.10358 WP_000368338.1.10408 WP_000368338.1.1043 WP_000368338.1.10436 WP_000368338.1.10450 WP_000368338.1.10469 WP_000368338.1.10478 WP_000368338.1.10481 WP_000368338.1.10526 WP_000368338.1.10583 WP_000368338.1.1060 WP_000368338.1.10617 WP_000368338.1.10624 WP_000368338.1.10664 WP_000368338.1.10749 WP_000368338.1.10751 WP_000368338.1.1077 WP_000368338.1.10783 WP_000368338.1.10785 WP_000368338.1.10823 WP_000368338.1.10843 WP_000368338.1.10858 WP_000368338.1.10917 WP_000368338.1.10919 WP_000368338.1.10928 WP_000368338.1.10942 WP_000368338.1.10965 WP_000368338.1.10969 WP_000368338.1.1097 WP_000368338.1.10976 WP_000368338.1.10979 WP_000368338.1.10986 WP_000368338.1.11001 WP_000368338.1.11067 WP_000368338.1.11069 WP_000368338.1.11073 WP_000368338.1.11074 WP_000368338.1.11076 WP_000368338.1.11083 WP_000368338.1.11084 WP_000368338.1.1115 WP_000368338.1.11162 WP_000368338.1.11184 WP_000368338.1.11188 WP_000368338.1.11202 WP_000368338.1.11220 WP_000368338.1.11223 WP_000368338.1.11228 WP_000368338.1.11234 WP_000368338.1.1124 WP_000368338.1.11261 WP_000368338.1.11281 WP_000368338.1.11282 WP_000368338.1.11286 WP_000368338.1.11312 WP_000368338.1.11322 WP_000368338.1.11333 WP_000368338.1.11365 WP_000368338.1.11378 WP_000368338.1.11391 WP_000368338.1.11403 WP_000368338.1.11434 WP_000368338.1.11441 WP_000368338.1.11447 WP_000368338.1.11451 WP_000368338.1.11463 WP_000368338.1.1147 WP_000368338.1.11475 WP_000368338.1.11494 WP_000368338.1.11504 WP_000368338.1.1151 WP_000368338.1.11513 WP_000368338.1.1152 WP_000368338.1.11540 WP_000368338.1.11556 WP_000368338.1.11571 WP_000368338.1.11580 WP_000368338.1.11611 WP_000368338.1.11625 WP_000368338.1.11640 WP_000368338.1.11646 WP_000368338.1.11660 WP_000368338.1.11663 WP_000368338.1.1171 WP_000368338.1.11723 WP_000368338.1.11730 WP_000368338.1.11736 WP_000368338.1.11741 WP_000368338.1.11768 WP_000368338.1.11781 WP_000368338.1.11794 WP_000368338.1.11816 WP_000368338.1.11828 WP_000368338.1.11837 WP_000368338.1.11884 WP_000368338.1.11894 WP_000368338.1.11903 WP_000368338.1.11904 WP_000368338.1.11919 WP_000368338.1.11969 WP_000368338.1.12019 WP_000368338.1.12026 WP_000368338.1.12029 WP_000368338.1.12042 WP_000368338.1.1210 WP_000368338.1.1213 WP_000368338.1.12137 WP_000368338.1.12149 WP_000368338.1.12152 WP_000368338.1.12158 WP_000368338.1.12170 WP_000368338.1.12175 WP_000368338.1.12193 WP_000368338.1.12194 WP_000368338.1.12201 WP_000368338.1.12234 WP_000368338.1.12256 WP_000368338.1.12272 WP_000368338.1.12330 WP_000368338.1.12437 WP_000368338.1.12508 WP_000368338.1.12516 WP_000368338.1.1253 WP_000368338.1.12555 WP_000368338.1.1257 WP_000368338.1.12597 WP_000368338.1.12598 WP_000368338.1.12605 WP_000368338.1.12608 WP_000368338.1.12618 WP_000368338.1.12668 WP_000368338.1.12685 WP_000368338.1.12705 WP_000368338.1.12707 WP_000368338.1.12711 WP_000368338.1.12733 WP_000368338.1.12737 WP_000368338.1.1276 WP_000368338.1.12770 WP_000368338.1.12772 WP_000368338.1.12780 WP_000368338.1.12788 WP_000368338.1.12802 WP_000368338.1.12829 WP_000368338.1.12858 WP_000368338.1.12884 WP_000368338.1.12886 WP_000368338.1.12904 WP_000368338.1.12920 WP_000368338.1.12951 WP_000368338.1.12977 WP_000368338.1.13013 WP_000368338.1.13062 WP_000368338.1.13112 WP_000368338.1.13154 WP_000368338.1.13169 WP_000368338.1.13170 WP_000368338.1.13189 WP_000368338.1.13228 WP_000368338.1.13243 WP_000368338.1.13250 WP_000368338.1.13303 WP_000368338.1.13326 WP_000368338.1.13336 WP_000368338.1.13355 WP_000368338.1.13366 WP_000368338.1.13376 WP_000368338.1.13379 WP_000368338.1.13381 WP_000368338.1.13405 WP_000368338.1.13448 WP_000368338.1.13501 WP_000368338.1.13505 WP_000368338.1.13514 WP_000368338.1.13532 WP_000368338.1.13554 WP_000368338.1.13557 WP_000368338.1.13598 WP_000368338.1.13612 WP_000368338.1.13665 WP_000368338.1.13668 WP_000368338.1.13670 WP_000368338.1.13679 WP_000368338.1.13680 WP_000368338.1.13696 WP_000368338.1.13709 WP_000368338.1.13728 WP_000368338.1.13733 WP_000368338.1.13734 WP_000368338.1.1375 WP_000368338.1.13769 WP_000368338.1.13787 WP_000368338.1.13807 WP_000368338.1.13831 WP_000368338.1.13870 WP_000368338.1.13879 WP_000368338.1.13884 WP_000368338.1.13897 WP_000368338.1.13904 WP_000368338.1.13933 WP_000368338.1.13947 WP_000368338.1.13948 WP_000368338.1.13986 WP_000368338.1.13987 WP_000368338.1.14010 WP_000368338.1.14025 WP_000368338.1.14034 WP_000368338.1.14097 WP_000368338.1.14143 WP_000368338.1.14163 WP_000368338.1.1418 WP_000368338.1.14192 WP_000368338.1.1420 WP_000368338.1.14201 WP_000368338.1.14221 WP_000368338.1.1425 WP_000368338.1.14272 WP_000368338.1.14281 WP_000368338.1.1429 WP_000368338.1.14298 WP_000368338.1.14302 WP_000368338.1.14305 WP_000368338.1.14314 WP_000368338.1.14337 WP_000368338.1.14342 WP_000368338.1.14349 WP_000368338.1.14355 WP_000368338.1.14358 WP_000368338.1.14363 WP_000368338.1.14372 WP_000368338.1.14397 WP_000368338.1.14412 WP_000368338.1.14535 WP_000368338.1.14546 WP_000368338.1.14577 WP_000368338.1.14596 WP_000368338.1.14639 WP_000368338.1.14665 WP_000368338.1.14666 WP_000368338.1.14681 WP_000368338.1.14696 WP_000368338.1.1471 WP_000368338.1.14729 WP_000368338.1.14734 WP_000368338.1.14747 WP_000368338.1.14770 WP_000368338.1.14774 WP_000368338.1.14782 WP_000368338.1.14787 WP_000368338.1.14823 WP_000368338.1.14825 WP_000368338.1.14846 WP_000368338.1.14866 WP_000368338.1.14868 WP_000368338.1.14874 WP_000368338.1.1490 WP_000368338.1.14967 WP_000368338.1.14970 WP_000368338.1.15015 WP_000368338.1.15022 WP_000368338.1.15029 WP_000368338.1.15039 WP_000368338.1.15071 WP_000368338.1.15108 WP_000368338.1.15150 WP_000368338.1.15173 WP_000368338.1.15182 WP_000368338.1.15185 WP_000368338.1.1520 WP_000368338.1.15201 WP_000368338.1.15206 WP_000368338.1.15234 WP_000368338.1.15241 WP_000368338.1.1525 WP_000368338.1.15268 WP_000368338.1.15269 WP_000368338.1.15294 WP_000368338.1.15296 WP_000368338.1.15389 WP_000368338.1.15421 WP_000368338.1.15507 WP_000368338.1.15519 WP_000368338.1.15532 WP_000368338.1.15533 WP_000368338.1.15544 WP_000368338.1.15546 WP_000368338.1.15554 WP_000368338.1.1558 WP_000368338.1.15591 WP_000368338.1.1562 WP_000368338.1.1564 WP_000368338.1.15641 WP_000368338.1.15679 WP_000368338.1.15691 WP_000368338.1.15712 WP_000368338.1.15722 WP_000368338.1.15753 WP_000368338.1.15785 WP_000368338.1.15812 WP_000368338.1.15819 WP_000368338.1.1586 WP_000368338.1.15888 WP_000368338.1.159 WP_000368338.1.15920 WP_000368338.1.15921 WP_000368338.1.15925 WP_000368338.1.15939 WP_000368338.1.15948 WP_000368338.1.1599 WP_000368338.1.16018 WP_000368338.1.16026 WP_000368338.1.16068 WP_000368338.1.16083 WP_000368338.1.16095 WP_000368338.1.16096 WP_000368338.1.16098 WP_000368338.1.16114 WP_000368338.1.16140 WP_000368338.1.16157 WP_000368338.1.16173 WP_000368338.1.16195 WP_000368338.1.16203 WP_000368338.1.16214 WP_000368338.1.16223 WP_000368338.1.1623 WP_000368338.1.16251 WP_000368338.1.16265 WP_000368338.1.16276 WP_000368338.1.16283 WP_000368338.1.16311 WP_000368338.1.16372 WP_000368338.1.16395 WP_000368338.1.16399 WP_000368338.1.16407 WP_000368338.1.16408 WP_000368338.1.16414 WP_000368338.1.16433 WP_000368338.1.16436 WP_000368338.1.16455 WP_000368338.1.16458 WP_000368338.1.16467 WP_000368338.1.16478 WP_000368338.1.16564 WP_000368338.1.16589 WP_000368338.1.16606 WP_000368338.1.1662 WP_000368338.1.16632 WP_000368338.1.16639 WP_000368338.1.16649 WP_000368338.1.1665 WP_000368338.1.16651 WP_000368338.1.16653 WP_000368338.1.1666 WP_000368338.1.16664 WP_000368338.1.16684 WP_000368338.1.16693 WP_000368338.1.16747 WP_000368338.1.16761 WP_000368338.1.16762 WP_000368338.1.16794 WP_000368338.1.16802 WP_000368338.1.16815 WP_000368338.1.16824 WP_000368338.1.16833 WP_000368338.1.16880 WP_000368338.1.16882 WP_000368338.1.16920 WP_000368338.1.16925 WP_000368338.1.16936 WP_000368338.1.16938 WP_000368338.1.16969 WP_000368338.1.16986 WP_000368338.1.17009 WP_000368338.1.17046 WP_000368338.1.17050 WP_000368338.1.17080 WP_000368338.1.17122 WP_000368338.1.17132 WP_000368338.1.17139 WP_000368338.1.17143 WP_000368338.1.17156 WP_000368338.1.17157 WP_000368338.1.17176 WP_000368338.1.17180 WP_000368338.1.17193 WP_000368338.1.17200 WP_000368338.1.17201 WP_000368338.1.17240 WP_000368338.1.17248 WP_000368338.1.17289 WP_000368338.1.1729 WP_000368338.1.17296 WP_000368338.1.17309 WP_000368338.1.17327 WP_000368338.1.1736 WP_000368338.1.1740 WP_000368338.1.1741 WP_000368338.1.17419 WP_000368338.1.17454 WP_000368338.1.17456 WP_000368338.1.17475 WP_000368338.1.17524 WP_000368338.1.17526 WP_000368338.1.17529 WP_000368338.1.17531 WP_000368338.1.1756 WP_000368338.1.17569 WP_000368338.1.17590 WP_000368338.1.17643 WP_000368338.1.1765 WP_000368338.1.17651 WP_000368338.1.17658 WP_000368338.1.17671 WP_000368338.1.1771 WP_000368338.1.17717 WP_000368338.1.17718 WP_000368338.1.17720 WP_000368338.1.17725 WP_000368338.1.17737 WP_000368338.1.17796 WP_000368338.1.17818 WP_000368338.1.17832 WP_000368338.1.17835 WP_000368338.1.17838 WP_000368338.1.17847 WP_000368338.1.17853 WP_000368338.1.1787 WP_000368338.1.17882 WP_000368338.1.17909 WP_000368338.1.17922 WP_000368338.1.17928 WP_000368338.1.17943 WP_000368338.1.17966 WP_000368338.1.17974 WP_000368338.1.17987 WP_000368338.1.18011 WP_000368338.1.18043 WP_000368338.1.18069 WP_000368338.1.18080 WP_000368338.1.1811 WP_000368338.1.18113 WP_000368338.1.18132 WP_000368338.1.18140 WP_000368338.1.18153 WP_000368338.1.18203 WP_000368338.1.18237 WP_000368338.1.18248 WP_000368338.1.18261 WP_000368338.1.18273 WP_000368338.1.18288 WP_000368338.1.1829 WP_000368338.1.18301 WP_000368338.1.18309 WP_000368338.1.18310 WP_000368338.1.18360 WP_000368338.1.18412 WP_000368338.1.18424 WP_000368338.1.18429 WP_000368338.1.18466 WP_000368338.1.1847 WP_000368338.1.18487 WP_000368338.1.1849 WP_000368338.1.18495 WP_000368338.1.18497 WP_000368338.1.185 WP_000368338.1.18504 WP_000368338.1.18506 WP_000368338.1.18507 WP_000368338.1.18526 WP_000368338.1.18539 WP_000368338.1.18545 WP_000368338.1.18560 WP_000368338.1.18566 WP_000368338.1.18570 WP_000368338.1.18590 WP_000368338.1.18591 WP_000368338.1.18605 WP_000368338.1.18632 WP_000368338.1.18656 WP_000368338.1.18679 WP_000368338.1.18719 WP_000368338.1.18741 WP_000368338.1.18763 WP_000368338.1.18774 WP_000368338.1.18779 WP_000368338.1.18792 WP_000368338.1.18799 WP_000368338.1.18818 WP_000368338.1.18819 WP_000368338.1.18834 WP_000368338.1.18870 WP_000368338.1.18882 WP_000368338.1.1892 WP_000368338.1.18963 WP_000368338.1.18965 WP_000368338.1.18968 WP_000368338.1.18974 WP_000368338.1.19014 WP_000368338.1.19022 WP_000368338.1.19052 WP_000368338.1.19082 WP_000368338.1.19102 WP_000368338.1.19109 WP_000368338.1.1911 WP_000368338.1.1912 WP_000368338.1.1921 WP_000368338.1.19259 WP_000368338.1.19301 WP_000368338.1.19306 WP_000368338.1.19322 WP_000368338.1.19365 WP_000368338.1.19375 WP_000368338.1.19377 WP_000368338.1.19386 WP_000368338.1.1940 WP_000368338.1.1943 WP_000368338.1.19430 WP_000368338.1.19450 WP_000368338.1.19455 WP_000368338.1.19497 WP_000368338.1.19515 WP_000368338.1.19555 WP_000368338.1.19577 WP_000368338.1.19611 WP_000368338.1.1962 WP_000368338.1.1964 WP_000368338.1.19643 WP_000368338.1.19653 WP_000368338.1.19700 WP_000368338.1.19701 WP_000368338.1.19717 WP_000368338.1.19725 WP_000368338.1.19732 WP_000368338.1.1974 WP_000368338.1.19748 WP_000368338.1.19759 WP_000368338.1.19788 WP_000368338.1.19792 WP_000368338.1.19801 WP_000368338.1.19816 WP_000368338.1.19848 WP_000368338.1.19881 WP_000368338.1.19891 WP_000368338.1.19904 WP_000368338.1.19905 WP_000368338.1.19912 WP_000368338.1.19921 WP_000368338.1.19928 WP_000368338.1.19968 WP_000368338.1.19980 WP_000368338.1.19981 WP_000368338.1.19982 WP_000368338.1.20006 WP_000368338.1.20049 WP_000368338.1.20052 WP_000368338.1.2007 WP_000368338.1.20078 WP_000368338.1.2008 WP_000368338.1.20090 WP_000368338.1.20100 WP_000368338.1.20156 WP_000368338.1.20161 WP_000368338.1.20167 WP_000368338.1.20177 WP_000368338.1.20191 WP_000368338.1.20201 WP_000368338.1.20214 WP_000368338.1.20219 WP_000368338.1.20221 WP_000368338.1.20245 WP_000368338.1.2025 WP_000368338.1.2029 WP_000368338.1.20307 WP_000368338.1.20324 WP_000368338.1.20340 WP_000368338.1.20358 WP_000368338.1.20398 WP_000368338.1.20399 WP_000368338.1.20411 WP_000368338.1.20447 WP_000368338.1.20479 WP_000368338.1.20487 WP_000368338.1.20496 WP_000368338.1.20500 WP_000368338.1.20512 WP_000368338.1.20550 WP_000368338.1.20558 WP_000368338.1.2056 WP_000368338.1.20579 WP_000368338.1.20585 WP_000368338.1.20598 WP_000368338.1.20611 WP_000368338.1.20618 WP_000368338.1.20619 WP_000368338.1.20620 WP_000368338.1.20649 WP_000368338.1.20690 WP_000368338.1.20698 WP_000368338.1.20736 WP_000368338.1.20796 WP_000368338.1.20821 WP_000368338.1.20846 WP_000368338.1.20866 WP_000368338.1.20867 WP_000368338.1.20878 WP_000368338.1.20906 WP_000368338.1.20913 WP_000368338.1.20922 WP_000368338.1.20935 WP_000368338.1.20939 WP_000368338.1.20945 WP_000368338.1.20971 WP_000368338.1.20979 WP_000368338.1.21009 WP_000368338.1.21015 WP_000368338.1.21031 WP_000368338.1.21036 WP_000368338.1.21056 WP_000368338.1.21064 WP_000368338.1.21066 WP_000368338.1.21078 WP_000368338.1.21102 WP_000368338.1.21109 WP_000368338.1.21111 WP_000368338.1.21140 WP_000368338.1.21154 WP_000368338.1.21183 WP_000368338.1.2119 WP_000368338.1.21222 WP_000368338.1.21257 WP_000368338.1.21259 WP_000368338.1.21272 WP_000368338.1.21313 WP_000368338.1.21314 WP_000368338.1.21339 WP_000368338.1.2135 WP_000368338.1.21359 WP_000368338.1.21375 WP_000368338.1.21379 WP_000368338.1.21393 WP_000368338.1.21412 WP_000368338.1.21416 WP_000368338.1.21449 WP_000368338.1.21458 WP_000368338.1.21464 WP_000368338.1.21477 WP_000368338.1.21480 WP_000368338.1.21500 WP_000368338.1.21505 WP_000368338.1.21514 WP_000368338.1.21572 WP_000368338.1.21589 WP_000368338.1.2159 WP_000368338.1.2160 WP_000368338.1.21621 WP_000368338.1.21636 WP_000368338.1.21719 WP_000368338.1.21724 WP_000368338.1.21746 WP_000368338.1.21763 WP_000368338.1.2178 WP_000368338.1.21787 WP_000368338.1.21828 WP_000368338.1.21830 WP_000368338.1.21894 WP_000368338.1.21900 WP_000368338.1.21919 WP_000368338.1.21954 WP_000368338.1.21985 WP_000368338.1.21988 WP_000368338.1.2200 WP_000368338.1.22000 WP_000368338.1.22011 WP_000368338.1.22022 WP_000368338.1.22027 WP_000368338.1.22033 WP_000368338.1.22038 WP_000368338.1.22049 WP_000368338.1.22065 WP_000368338.1.22082 WP_000368338.1.22093 WP_000368338.1.2211 WP_000368338.1.22111 WP_000368338.1.22164 WP_000368338.1.22177 WP_000368338.1.22197 WP_000368338.1.22200 WP_000368338.1.22227 WP_000368338.1.22259 WP_000368338.1.22302 WP_000368338.1.22307 WP_000368338.1.22400 WP_000368338.1.22418 WP_000368338.1.22419 WP_000368338.1.22426 WP_000368338.1.22441 WP_000368338.1.22493 WP_000368338.1.22498 WP_000368338.1.22512 WP_000368338.1.22533 WP_000368338.1.22547 WP_000368338.1.22559 WP_000368338.1.22650 WP_000368338.1.22684 WP_000368338.1.22696 WP_000368338.1.22702 WP_000368338.1.22709 WP_000368338.1.22714 WP_000368338.1.22727 WP_000368338.1.22738 WP_000368338.1.22739 WP_000368338.1.22764 WP_000368338.1.22787 WP_000368338.1.22789 WP_000368338.1.22790 WP_000368338.1.22792 WP_000368338.1.22803 WP_000368338.1.22808 WP_000368338.1.22826 WP_000368338.1.22853 WP_000368338.1.22890 WP_000368338.1.22924 WP_000368338.1.22969 WP_000368338.1.22975 WP_000368338.1.22983 WP_000368338.1.22984 WP_000368338.1.23012 WP_000368338.1.23061 WP_000368338.1.23069 WP_000368338.1.23082 WP_000368338.1.23103 WP_000368338.1.23121 WP_000368338.1.23130 WP_000368338.1.23132 WP_000368338.1.23133 WP_000368338.1.23146 WP_000368338.1.23161 WP_000368338.1.23185 WP_000368338.1.23194 WP_000368338.1.23217 WP_000368338.1.23244 WP_000368338.1.23251 WP_000368338.1.2327 WP_000368338.1.23275 WP_000368338.1.23288 WP_000368338.1.23304 WP_000368338.1.23413 WP_000368338.1.23431 WP_000368338.1.23439 WP_000368338.1.23449 WP_000368338.1.23476 WP_000368338.1.23516 WP_000368338.1.23517 WP_000368338.1.23531 WP_000368338.1.23568 WP_000368338.1.23572 WP_000368338.1.23580 WP_000368338.1.23617 WP_000368338.1.23630 WP_000368338.1.23644 WP_000368338.1.23671 WP_000368338.1.23690 WP_000368338.1.23708 WP_000368338.1.23710 WP_000368338.1.23730 WP_000368338.1.23740 WP_000368338.1.23796 WP_000368338.1.2382 WP_000368338.1.23842 WP_000368338.1.23856 WP_000368338.1.2389 WP_000368338.1.23896 WP_000368338.1.23900 WP_000368338.1.23902 WP_000368338.1.23926 WP_000368338.1.23944 WP_000368338.1.23956 WP_000368338.1.23972 WP_000368338.1.23995 WP_000368338.1.24000 WP_000368338.1.24081 WP_000368338.1.24154 WP_000368338.1.2420 WP_000368338.1.24207 WP_000368338.1.24213 WP_000368338.1.24226 WP_000368338.1.24263 WP_000368338.1.2427 WP_000368338.1.24275 WP_000368338.1.24276 WP_000368338.1.24277 WP_000368338.1.24286 WP_000368338.1.24302 WP_000368338.1.2434 WP_000368338.1.24343 WP_000368338.1.24347 WP_000368338.1.24365 WP_000368338.1.24388 WP_000368338.1.24416 WP_000368338.1.24436 WP_000368338.1.24437 WP_000368338.1.24439 WP_000368338.1.24469 WP_000368338.1.2450 WP_000368338.1.24502 WP_000368338.1.24516 WP_000368338.1.24519 WP_000368338.1.24569 WP_000368338.1.24572 WP_000368338.1.24589 WP_000368338.1.24596 WP_000368338.1.24597 WP_000368338.1.24602 WP_000368338.1.24625 WP_000368338.1.24631 WP_000368338.1.24644 WP_000368338.1.24654 WP_000368338.1.24674 WP_000368338.1.24679 WP_000368338.1.24681 WP_000368338.1.24711 WP_000368338.1.24714 WP_000368338.1.24780 WP_000368338.1.24817 WP_000368338.1.24823 WP_000368338.1.24834 WP_000368338.1.24855 WP_000368338.1.24856 WP_000368338.1.24918 WP_000368338.1.24937 WP_000368338.1.2497 WP_000368338.1.24996 WP_000368338.1.25001 WP_000368338.1.25007 WP_000368338.1.2501 WP_000368338.1.25012 WP_000368338.1.25029 WP_000368338.1.2506 WP_000368338.1.25070 WP_000368338.1.25092 WP_000368338.1.25095 WP_000368338.1.25098 WP_000368338.1.25115 WP_000368338.1.25117 WP_000368338.1.25145 WP_000368338.1.25167 WP_000368338.1.25187 WP_000368338.1.25209 WP_000368338.1.25216 WP_000368338.1.2522 WP_000368338.1.25221 WP_000368338.1.25287 WP_000368338.1.25288 WP_000368338.1.25331 WP_000368338.1.25341 WP_000368338.1.25345 WP_000368338.1.25361 WP_000368338.1.2544 WP_000368338.1.25459 WP_000368338.1.25488 WP_000368338.1.25489 WP_000368338.1.25495 WP_000368338.1.2552 WP_000368338.1.25557 WP_000368338.1.25569 WP_000368338.1.25591 WP_000368338.1.25595 WP_000368338.1.25597 WP_000368338.1.25621 WP_000368338.1.25623 WP_000368338.1.25633 WP_000368338.1.25651 WP_000368338.1.257 WP_000368338.1.25721 WP_000368338.1.25732 WP_000368338.1.25744 WP_000368338.1.25758 WP_000368338.1.25772 WP_000368338.1.25776 WP_000368338.1.25779 WP_000368338.1.25802 WP_000368338.1.25840 WP_000368338.1.25852 WP_000368338.1.25856 WP_000368338.1.25857 WP_000368338.1.2590 WP_000368338.1.25910 WP_000368338.1.2592 WP_000368338.1.25929 WP_000368338.1.25930 WP_000368338.1.25955 WP_000368338.1.25984 WP_000368338.1.26012 WP_000368338.1.26033 WP_000368338.1.26039 WP_000368338.1.26050 WP_000368338.1.26058 WP_000368338.1.2608 WP_000368338.1.26086 WP_000368338.1.26094 WP_000368338.1.26106 WP_000368338.1.26143 WP_000368338.1.26169 WP_000368338.1.26172 WP_000368338.1.2619 WP_000368338.1.2621 WP_000368338.1.26225 WP_000368338.1.26226 WP_000368338.1.26255 WP_000368338.1.26266 WP_000368338.1.26271 WP_000368338.1.26276 WP_000368338.1.26283 WP_000368338.1.26289 WP_000368338.1.26290 WP_000368338.1.26298 WP_000368338.1.26306 WP_000368338.1.26314 WP_000368338.1.26315 WP_000368338.1.26318 WP_000368338.1.26340 WP_000368338.1.26345 WP_000368338.1.26346 WP_000368338.1.26354 WP_000368338.1.26359 WP_000368338.1.26364 WP_000368338.1.26397 WP_000368338.1.26399 WP_000368338.1.26404 WP_000368338.1.26424 WP_000368338.1.2643 WP_000368338.1.26431 WP_000368338.1.2645 WP_000368338.1.26506 WP_000368338.1.26533 WP_000368338.1.26555 WP_000368338.1.26584 WP_000368338.1.26650 WP_000368338.1.26662 WP_000368338.1.26664 WP_000368338.1.26677 WP_000368338.1.26726 WP_000368338.1.2673 WP_000368338.1.2674 WP_000368338.1.26749 WP_000368338.1.26772 WP_000368338.1.26773 WP_000368338.1.26778 WP_000368338.1.2680 WP_000368338.1.26804 WP_000368338.1.2684 WP_000368338.1.26840 WP_000368338.1.26850 WP_000368338.1.26864 WP_000368338.1.26865 WP_000368338.1.2687 WP_000368338.1.26884 WP_000368338.1.26886 WP_000368338.1.2689 WP_000368338.1.26903 WP_000368338.1.26905 WP_000368338.1.26929 WP_000368338.1.26938 WP_000368338.1.26947 WP_000368338.1.26963 WP_000368338.1.2697 WP_000368338.1.27013 WP_000368338.1.27053 WP_000368338.1.27080 WP_000368338.1.27083 WP_000368338.1.27097 WP_000368338.1.2710 WP_000368338.1.27120 WP_000368338.1.27127 WP_000368338.1.27147 WP_000368338.1.27160 WP_000368338.1.27166 WP_000368338.1.27168 WP_000368338.1.27170 WP_000368338.1.2718 WP_000368338.1.27182 WP_000368338.1.2719 WP_000368338.1.27199 WP_000368338.1.27226 WP_000368338.1.27237 WP_000368338.1.2725 WP_000368338.1.27262 WP_000368338.1.27293 WP_000368338.1.27294 WP_000368338.1.27303 WP_000368338.1.27323 WP_000368338.1.27379 WP_000368338.1.27384 WP_000368338.1.27387 WP_000368338.1.27413 WP_000368338.1.27415 WP_000368338.1.2744 WP_000368338.1.27447 WP_000368338.1.27456 WP_000368338.1.27467 WP_000368338.1.27468 WP_000368338.1.27489 WP_000368338.1.27516 WP_000368338.1.27529 WP_000368338.1.2753 WP_000368338.1.27539 WP_000368338.1.27590 WP_000368338.1.27605 WP_000368338.1.27622 WP_000368338.1.27628 WP_000368338.1.27646 WP_000368338.1.27662 WP_000368338.1.27673 WP_000368338.1.27689 WP_000368338.1.27696 WP_000368338.1.27720 WP_000368338.1.27739 WP_000368338.1.27744 WP_000368338.1.27765 WP_000368338.1.27787 WP_000368338.1.27793 WP_000368338.1.27799 WP_000368338.1.27830 WP_000368338.1.27834 WP_000368338.1.27929 WP_000368338.1.2795 WP_000368338.1.27999 WP_000368338.1.2800 WP_000368338.1.28016 WP_000368338.1.28074 WP_000368338.1.28079 WP_000368338.1.2808 WP_000368338.1.28081 WP_000368338.1.28091 WP_000368338.1.28105 WP_000368338.1.28107 WP_000368338.1.28173 WP_000368338.1.28213 WP_000368338.1.28226 WP_000368338.1.28230 WP_000368338.1.28253 WP_000368338.1.28257 WP_000368338.1.28274 WP_000368338.1.28298 WP_000368338.1.28315 WP_000368338.1.28319 WP_000368338.1.28337 WP_000368338.1.28347 WP_000368338.1.28392 WP_000368338.1.28394 WP_000368338.1.2840 WP_000368338.1.28400 WP_000368338.1.28426 WP_000368338.1.28430 WP_000368338.1.28447 WP_000368338.1.28482 WP_000368338.1.28490 WP_000368338.1.28501 WP_000368338.1.28526 WP_000368338.1.28564 WP_000368338.1.28578 WP_000368338.1.28580 WP_000368338.1.28584 WP_000368338.1.28605 WP_000368338.1.28614 WP_000368338.1.2862 WP_000368338.1.28636 WP_000368338.1.28652 WP_000368338.1.28672 WP_000368338.1.28690 WP_000368338.1.28691 WP_000368338.1.28720 WP_000368338.1.28763 WP_000368338.1.28784 WP_000368338.1.28785 WP_000368338.1.28825 WP_000368338.1.28833 WP_000368338.1.28848 WP_000368338.1.28871 WP_000368338.1.28874 WP_000368338.1.28909 WP_000368338.1.2891 WP_000368338.1.28915 WP_000368338.1.28925 WP_000368338.1.28934 WP_000368338.1.28981 WP_000368338.1.28987 WP_000368338.1.29014 WP_000368338.1.29052 WP_000368338.1.2906 WP_000368338.1.29060 WP_000368338.1.29091 WP_000368338.1.29110 WP_000368338.1.29112 WP_000368338.1.2913 WP_000368338.1.29155 WP_000368338.1.29166 WP_000368338.1.29170 WP_000368338.1.29187 WP_000368338.1.29226 WP_000368338.1.29242 WP_000368338.1.29244 WP_000368338.1.29250 WP_000368338.1.29263 WP_000368338.1.29276 WP_000368338.1.29301 WP_000368338.1.29315 WP_000368338.1.29329 WP_000368338.1.29340 WP_000368338.1.29366 WP_000368338.1.29368 WP_000368338.1.29375 WP_000368338.1.29395 WP_000368338.1.29433 WP_000368338.1.29445 WP_000368338.1.29453 WP_000368338.1.29468 WP_000368338.1.29479 WP_000368338.1.29483 WP_000368338.1.29484 WP_000368338.1.29522 WP_000368338.1.29557 WP_000368338.1.2957 WP_000368338.1.29571 WP_000368338.1.29692 WP_000368338.1.29709 WP_000368338.1.29710 WP_000368338.1.29716 WP_000368338.1.2972 WP_000368338.1.29731 WP_000368338.1.29736 WP_000368338.1.29744 WP_000368338.1.29788 WP_000368338.1.2981 WP_000368338.1.29826 WP_000368338.1.2983 WP_000368338.1.29862 WP_000368338.1.29902 WP_000368338.1.29905 WP_000368338.1.29918 WP_000368338.1.29956 WP_000368338.1.2997 WP_000368338.1.29981 WP_000368338.1.29982 WP_000368338.1.30051 WP_000368338.1.30089 WP_000368338.1.30095 WP_000368338.1.30100 WP_000368338.1.30115 WP_000368338.1.3012 WP_000368338.1.30130 WP_000368338.1.30150 WP_000368338.1.30152 WP_000368338.1.30159 WP_000368338.1.30169 WP_000368338.1.30188 WP_000368338.1.30190 WP_000368338.1.30191 WP_000368338.1.30197 WP_000368338.1.30203 WP_000368338.1.30204 WP_000368338.1.30209 WP_000368338.1.30230 WP_000368338.1.30249 WP_000368338.1.30268 WP_000368338.1.3029 WP_000368338.1.30294 WP_000368338.1.30302 WP_000368338.1.30307 WP_000368338.1.30328 WP_000368338.1.30350 WP_000368338.1.30364 WP_000368338.1.30385 WP_000368338.1.30392 WP_000368338.1.30482 WP_000368338.1.30496 WP_000368338.1.3050 WP_000368338.1.30508 WP_000368338.1.30531 WP_000368338.1.30560 WP_000368338.1.30566 WP_000368338.1.30568 WP_000368338.1.30600 WP_000368338.1.30622 WP_000368338.1.30645 WP_000368338.1.30646 WP_000368338.1.30648 WP_000368338.1.30650 WP_000368338.1.30652 WP_000368338.1.30666 WP_000368338.1.30668 WP_000368338.1.30690 WP_000368338.1.30702 WP_000368338.1.30720 WP_000368338.1.30726 WP_000368338.1.30763 WP_000368338.1.30768 WP_000368338.1.3077 WP_000368338.1.30845 WP_000368338.1.30847 WP_000368338.1.30854 WP_000368338.1.30861 WP_000368338.1.30880 WP_000368338.1.30907 WP_000368338.1.30911 WP_000368338.1.30915 WP_000368338.1.30928 WP_000368338.1.30945 WP_000368338.1.30962 WP_000368338.1.31022 WP_000368338.1.31039 WP_000368338.1.31041 WP_000368338.1.31048 WP_000368338.1.31065 WP_000368338.1.31077 WP_000368338.1.31091 WP_000368338.1.31113 WP_000368338.1.31114 WP_000368338.1.31120 WP_000368338.1.31123 WP_000368338.1.31176 WP_000368338.1.31202 WP_000368338.1.31204 WP_000368338.1.31206 WP_000368338.1.31212 WP_000368338.1.3123 WP_000368338.1.31278 WP_000368338.1.31294 WP_000368338.1.31315 WP_000368338.1.31337 WP_000368338.1.31339 WP_000368338.1.31355 WP_000368338.1.31363 WP_000368338.1.31377 WP_000368338.1.31402 WP_000368338.1.31424 WP_000368338.1.31426 WP_000368338.1.31437 WP_000368338.1.31441 WP_000368338.1.31442 WP_000368338.1.31468 WP_000368338.1.31479 WP_000368338.1.31484 WP_000368338.1.31497 WP_000368338.1.31529 WP_000368338.1.31531 WP_000368338.1.31539 WP_000368338.1.31568 WP_000368338.1.31589 WP_000368338.1.31605 WP_000368338.1.31621 WP_000368338.1.31647 WP_000368338.1.31653 WP_000368338.1.31686 WP_000368338.1.31701 WP_000368338.1.31743 WP_000368338.1.31753 WP_000368338.1.31791 WP_000368338.1.31806 WP_000368338.1.31816 WP_000368338.1.31827 WP_000368338.1.31828 WP_000368338.1.31842 WP_000368338.1.3188 WP_000368338.1.31892 WP_000368338.1.31931 WP_000368338.1.31943 WP_000368338.1.31997 WP_000368338.1.32003 WP_000368338.1.32005 WP_000368338.1.32067 WP_000368338.1.32077 WP_000368338.1.32095 WP_000368338.1.32106 WP_000368338.1.32160 WP_000368338.1.3219 WP_000368338.1.32207 WP_000368338.1.32215 WP_000368338.1.32269 WP_000368338.1.32270 WP_000368338.1.3229 WP_000368338.1.32301 WP_000368338.1.3231 WP_000368338.1.32325 WP_000368338.1.32338 WP_000368338.1.32339 WP_000368338.1.32340 WP_000368338.1.32348 WP_000368338.1.3242 WP_000368338.1.32474 WP_000368338.1.32481 WP_000368338.1.32483 WP_000368338.1.32497 WP_000368338.1.32514 WP_000368338.1.32517 WP_000368338.1.32534 WP_000368338.1.32546 WP_000368338.1.32565 WP_000368338.1.32584 WP_000368338.1.32599 WP_000368338.1.32607 WP_000368338.1.32634 WP_000368338.1.32636 WP_000368338.1.32671 WP_000368338.1.32746 WP_000368338.1.32754 WP_000368338.1.32761 WP_000368338.1.32763 WP_000368338.1.32764 WP_000368338.1.32770 WP_000368338.1.32795 WP_000368338.1.328 WP_000368338.1.32800 WP_000368338.1.32829 WP_000368338.1.32898 WP_000368338.1.32925 WP_000368338.1.32928 WP_000368338.1.3293 WP_000368338.1.32939 WP_000368338.1.32954 WP_000368338.1.32965 WP_000368338.1.32980 WP_000368338.1.3301 WP_000368338.1.33029 WP_000368338.1.33038 WP_000368338.1.33048 WP_000368338.1.33110 WP_000368338.1.33123 WP_000368338.1.33138 WP_000368338.1.3316 WP_000368338.1.33161 WP_000368338.1.33199 WP_000368338.1.33212 WP_000368338.1.33250 WP_000368338.1.33266 WP_000368338.1.33277 WP_000368338.1.33296 WP_000368338.1.3330 WP_000368338.1.33322 WP_000368338.1.33328 WP_000368338.1.33335 WP_000368338.1.33357 WP_000368338.1.33368 WP_000368338.1.3341 WP_000368338.1.33416 WP_000368338.1.3342 WP_000368338.1.3343 WP_000368338.1.33432 WP_000368338.1.33468 WP_000368338.1.3347 WP_000368338.1.33507 WP_000368338.1.33516 WP_000368338.1.33518 WP_000368338.1.33538 WP_000368338.1.33540 WP_000368338.1.33567 WP_000368338.1.3357 WP_000368338.1.33594 WP_000368338.1.33607 WP_000368338.1.33610 WP_000368338.1.33626 WP_000368338.1.33627 WP_000368338.1.3363 WP_000368338.1.33654 WP_000368338.1.33655 WP_000368338.1.33692 WP_000368338.1.33695 WP_000368338.1.33707 WP_000368338.1.33718 WP_000368338.1.33720 WP_000368338.1.33735 WP_000368338.1.33743 WP_000368338.1.33765 WP_000368338.1.33767 WP_000368338.1.33769 WP_000368338.1.33792 WP_000368338.1.33804 WP_000368338.1.33813 WP_000368338.1.33850 WP_000368338.1.33915 WP_000368338.1.33963 WP_000368338.1.33966 WP_000368338.1.33968 WP_000368338.1.33971 WP_000368338.1.33983 WP_000368338.1.33989 WP_000368338.1.34026 WP_000368338.1.34030 WP_000368338.1.34051 WP_000368338.1.34060 WP_000368338.1.34062 WP_000368338.1.34078 WP_000368338.1.34079 WP_000368338.1.34080 WP_000368338.1.34089 WP_000368338.1.34100 WP_000368338.1.34132 WP_000368338.1.34168 WP_000368338.1.34172 WP_000368338.1.34182 WP_000368338.1.34209 WP_000368338.1.3422 WP_000368338.1.34231 WP_000368338.1.34244 WP_000368338.1.34249 WP_000368338.1.34250 WP_000368338.1.34251 WP_000368338.1.34254 WP_000368338.1.34280 WP_000368338.1.34285 WP_000368338.1.34307 WP_000368338.1.34334 WP_000368338.1.34381 WP_000368338.1.34403 WP_000368338.1.34410 WP_000368338.1.34427 WP_000368338.1.34438 WP_000368338.1.34473 WP_000368338.1.34482 WP_000368338.1.34492 WP_000368338.1.34502 WP_000368338.1.34510 WP_000368338.1.34526 WP_000368338.1.34578 WP_000368338.1.3461 WP_000368338.1.34626 WP_000368338.1.34666 WP_000368338.1.34677 WP_000368338.1.34733 WP_000368338.1.34737 WP_000368338.1.34767 WP_000368338.1.34774 WP_000368338.1.34818 WP_000368338.1.34877 WP_000368338.1.34890 WP_000368338.1.34912 WP_000368338.1.34918 WP_000368338.1.34943 WP_000368338.1.34970 WP_000368338.1.34998 WP_000368338.1.35029 WP_000368338.1.35054 WP_000368338.1.35059 WP_000368338.1.35062 WP_000368338.1.35089 WP_000368338.1.35097 WP_000368338.1.35106 WP_000368338.1.35108 WP_000368338.1.35110 WP_000368338.1.35121 WP_000368338.1.35177 WP_000368338.1.35182 WP_000368338.1.35183 WP_000368338.1.35189 WP_000368338.1.35194 WP_000368338.1.35222 WP_000368338.1.35233 WP_000368338.1.35243 WP_000368338.1.35257 WP_000368338.1.3526 WP_000368338.1.35264 WP_000368338.1.35276 WP_000368338.1.35285 WP_000368338.1.35297 WP_000368338.1.35334 WP_000368338.1.35342 WP_000368338.1.35345 WP_000368338.1.35352 WP_000368338.1.35415 WP_000368338.1.35423 WP_000368338.1.35433 WP_000368338.1.35435 WP_000368338.1.3547 WP_000368338.1.3549 WP_000368338.1.35490 WP_000368338.1.35497 WP_000368338.1.35498 WP_000368338.1.35506 WP_000368338.1.3552 WP_000368338.1.35525 WP_000368338.1.35580 WP_000368338.1.35615 WP_000368338.1.35623 WP_000368338.1.35643 WP_000368338.1.35673 WP_000368338.1.3569 WP_000368338.1.35730 WP_000368338.1.3574 WP_000368338.1.35742 WP_000368338.1.35746 WP_000368338.1.35774 WP_000368338.1.35794 WP_000368338.1.35799 WP_000368338.1.35801 WP_000368338.1.35826 WP_000368338.1.35900 WP_000368338.1.35928 WP_000368338.1.35933 WP_000368338.1.35950 WP_000368338.1.35958 WP_000368338.1.36004 WP_000368338.1.36021 WP_000368338.1.36041 WP_000368338.1.36082 WP_000368338.1.36102 WP_000368338.1.3611 WP_000368338.1.36117 WP_000368338.1.36119 WP_000368338.1.3617 WP_000368338.1.36175 WP_000368338.1.36176 WP_000368338.1.36187 WP_000368338.1.36188 WP_000368338.1.36193 WP_000368338.1.36211 WP_000368338.1.36220 WP_000368338.1.36223 WP_000368338.1.3623 WP_000368338.1.36231 WP_000368338.1.36250 WP_000368338.1.36264 WP_000368338.1.36278 WP_000368338.1.36282 WP_000368338.1.36283 WP_000368338.1.36307 WP_000368338.1.36325 WP_000368338.1.36344 WP_000368338.1.36389 WP_000368338.1.36522 WP_000368338.1.36532 WP_000368338.1.36535 WP_000368338.1.3655 WP_000368338.1.36551 WP_000368338.1.36570 WP_000368338.1.36580 WP_000368338.1.36600 WP_000368338.1.36604 WP_000368338.1.36615 WP_000368338.1.36646 WP_000368338.1.3666 WP_000368338.1.36689 WP_000368338.1.36697 WP_000368338.1.36698 WP_000368338.1.36745 WP_000368338.1.36754 WP_000368338.1.36770 WP_000368338.1.36783 WP_000368338.1.36793 WP_000368338.1.36796 WP_000368338.1.36797 WP_000368338.1.36809 WP_000368338.1.36820 WP_000368338.1.36822 WP_000368338.1.36823 WP_000368338.1.3685 WP_000368338.1.36858 WP_000368338.1.3687 WP_000368338.1.36884 WP_000368338.1.3690 WP_000368338.1.36916 WP_000368338.1.36932 WP_000368338.1.36952 WP_000368338.1.36955 WP_000368338.1.36962 WP_000368338.1.36979 WP_000368338.1.36980 WP_000368338.1.36997 WP_000368338.1.37002 WP_000368338.1.37016 WP_000368338.1.3703 WP_000368338.1.37044 WP_000368338.1.37045 WP_000368338.1.37053 WP_000368338.1.37055 WP_000368338.1.37075 WP_000368338.1.37080 WP_000368338.1.37091 WP_000368338.1.37121 WP_000368338.1.37132 WP_000368338.1.37134 WP_000368338.1.37135 WP_000368338.1.3718 WP_000368338.1.3719 WP_000368338.1.37220 WP_000368338.1.37304 WP_000368338.1.37336 WP_000368338.1.37341 WP_000368338.1.37354 WP_000368338.1.37398 WP_000368338.1.37408 WP_000368338.1.37424 WP_000368338.1.37453 WP_000368338.1.37467 WP_000368338.1.37503 WP_000368338.1.37525 WP_000368338.1.37536 WP_000368338.1.37563 WP_000368338.1.37578 WP_000368338.1.37583 WP_000368338.1.37602 WP_000368338.1.37605 WP_000368338.1.37606 WP_000368338.1.37621 WP_000368338.1.37624 WP_000368338.1.37636 WP_000368338.1.37652 WP_000368338.1.37781 WP_000368338.1.37795 WP_000368338.1.37815 WP_000368338.1.37828 WP_000368338.1.3784 WP_000368338.1.37866 WP_000368338.1.37875 WP_000368338.1.37891 WP_000368338.1.37953 WP_000368338.1.37987 WP_000368338.1.38007 WP_000368338.1.38020 WP_000368338.1.38034 WP_000368338.1.38038 WP_000368338.1.38057 WP_000368338.1.38070 WP_000368338.1.38082 WP_000368338.1.3809 WP_000368338.1.3813 WP_000368338.1.38148 WP_000368338.1.38160 WP_000368338.1.3817 WP_000368338.1.38177 WP_000368338.1.3820 WP_000368338.1.38212 WP_000368338.1.38230 WP_000368338.1.38232 WP_000368338.1.3827 WP_000368338.1.38276 WP_000368338.1.38282 WP_000368338.1.38309 WP_000368338.1.38311 WP_000368338.1.38330 WP_000368338.1.38336 WP_000368338.1.38339 WP_000368338.1.38346 WP_000368338.1.38383 WP_000368338.1.38390 WP_000368338.1.3842 WP_000368338.1.38422 WP_000368338.1.38437 WP_000368338.1.38453 WP_000368338.1.38489 WP_000368338.1.38491 WP_000368338.1.3850 WP_000368338.1.3852 WP_000368338.1.38522 WP_000368338.1.38551 WP_000368338.1.38557 WP_000368338.1.38600 WP_000368338.1.38607 WP_000368338.1.38612 WP_000368338.1.38637 WP_000368338.1.38651 WP_000368338.1.38669 WP_000368338.1.3867 WP_000368338.1.38674 WP_000368338.1.38721 WP_000368338.1.38760 WP_000368338.1.38786 WP_000368338.1.38788 WP_000368338.1.38823 WP_000368338.1.38836 WP_000368338.1.38841 WP_000368338.1.38858 WP_000368338.1.38862 WP_000368338.1.38926 WP_000368338.1.38931 WP_000368338.1.3894 WP_000368338.1.38940 WP_000368338.1.38943 WP_000368338.1.38960 WP_000368338.1.38972 WP_000368338.1.38973 WP_000368338.1.38979 WP_000368338.1.38985 WP_000368338.1.38989 WP_000368338.1.390 WP_000368338.1.39012 WP_000368338.1.39014 WP_000368338.1.39020 WP_000368338.1.39043 WP_000368338.1.39053 WP_000368338.1.3906 WP_000368338.1.3908 WP_000368338.1.39080 WP_000368338.1.39089 WP_000368338.1.391 WP_000368338.1.39117 WP_000368338.1.39173 WP_000368338.1.39203 WP_000368338.1.39206 WP_000368338.1.39217 WP_000368338.1.39241 WP_000368338.1.3926 WP_000368338.1.39272 WP_000368338.1.39281 WP_000368338.1.39285 WP_000368338.1.39290 WP_000368338.1.39332 WP_000368338.1.39333 WP_000368338.1.39347 WP_000368338.1.39368 WP_000368338.1.39378 WP_000368338.1.39384 WP_000368338.1.39397 WP_000368338.1.39406 WP_000368338.1.39486 WP_000368338.1.39494 WP_000368338.1.39506 WP_000368338.1.39519 WP_000368338.1.39550 WP_000368338.1.39613 WP_000368338.1.39625 WP_000368338.1.39645 WP_000368338.1.39662 WP_000368338.1.39687 WP_000368338.1.39689 WP_000368338.1.39697 WP_000368338.1.39711 WP_000368338.1.39738 WP_000368338.1.39767 WP_000368338.1.39773 WP_000368338.1.39789 WP_000368338.1.39812 WP_000368338.1.39832 WP_000368338.1.39834 WP_000368338.1.39838 WP_000368338.1.39839 WP_000368338.1.39847 WP_000368338.1.39856 WP_000368338.1.39869 WP_000368338.1.39875 WP_000368338.1.39880 WP_000368338.1.39883 WP_000368338.1.39918 WP_000368338.1.40014 WP_000368338.1.40043 WP_000368338.1.40053 WP_000368338.1.4006 WP_000368338.1.40082 WP_000368338.1.40085 WP_000368338.1.40099 WP_000368338.1.40119 WP_000368338.1.4012 WP_000368338.1.40120 WP_000368338.1.40130 WP_000368338.1.40137 WP_000368338.1.4015 WP_000368338.1.40161 WP_000368338.1.40164 WP_000368338.1.40173 WP_000368338.1.4019 WP_000368338.1.40220 WP_000368338.1.4025 WP_000368338.1.40316 WP_000368338.1.40318 WP_000368338.1.40320 WP_000368338.1.40322 WP_000368338.1.40340 WP_000368338.1.40342 WP_000368338.1.40368 WP_000368338.1.40383 WP_000368338.1.40401 WP_000368338.1.40406 WP_000368338.1.40435 WP_000368338.1.40443 WP_000368338.1.4045 WP_000368338.1.40454 WP_000368338.1.40458 WP_000368338.1.40463 WP_000368338.1.40472 WP_000368338.1.40474 WP_000368338.1.40481 WP_000368338.1.40505 WP_000368338.1.40531 WP_000368338.1.40532 WP_000368338.1.40554 WP_000368338.1.4056 WP_000368338.1.4057 WP_000368338.1.40579 WP_000368338.1.40588 WP_000368338.1.40620 WP_000368338.1.40644 WP_000368338.1.40655 WP_000368338.1.40658 WP_000368338.1.40659 WP_000368338.1.40748 WP_000368338.1.40760 WP_000368338.1.40794 WP_000368338.1.40797 WP_000368338.1.40800 WP_000368338.1.40816 WP_000368338.1.40954 WP_000368338.1.41002 WP_000368338.1.41011 WP_000368338.1.4102 WP_000368338.1.41058 WP_000368338.1.41064 WP_000368338.1.41066 WP_000368338.1.41084 WP_000368338.1.41094 WP_000368338.1.41098 WP_000368338.1.41104 WP_000368338.1.41109 WP_000368338.1.41119 WP_000368338.1.41122 WP_000368338.1.41129 WP_000368338.1.41133 WP_000368338.1.4115 WP_000368338.1.41178 WP_000368338.1.41208 WP_000368338.1.41238 WP_000368338.1.41241 WP_000368338.1.41245 WP_000368338.1.41255 WP_000368338.1.41288 WP_000368338.1.41289 WP_000368338.1.4129 WP_000368338.1.41314 WP_000368338.1.4138 WP_000368338.1.41411 WP_000368338.1.41426 WP_000368338.1.41432 WP_000368338.1.41433 WP_000368338.1.4144 WP_000368338.1.41448 WP_000368338.1.41456 WP_000368338.1.41458 WP_000368338.1.41461 WP_000368338.1.41473 WP_000368338.1.41499 WP_000368338.1.41532 WP_000368338.1.41533 WP_000368338.1.41558 WP_000368338.1.41567 WP_000368338.1.41582 WP_000368338.1.41597 WP_000368338.1.41599 WP_000368338.1.4160 WP_000368338.1.4162 WP_000368338.1.41674 WP_000368338.1.41698 WP_000368338.1.41726 WP_000368338.1.41770 WP_000368338.1.41817 WP_000368338.1.41821 WP_000368338.1.41839 WP_000368338.1.4188 WP_000368338.1.41891 WP_000368338.1.41898 WP_000368338.1.41906 WP_000368338.1.41935 WP_000368338.1.41943 WP_000368338.1.41954 WP_000368338.1.41983 WP_000368338.1.41989 WP_000368338.1.420 WP_000368338.1.42001 WP_000368338.1.42005 WP_000368338.1.42015 WP_000368338.1.42017 WP_000368338.1.42028 WP_000368338.1.42087 WP_000368338.1.42125 WP_000368338.1.42137 WP_000368338.1.42177 WP_000368338.1.42198 WP_000368338.1.42230 WP_000368338.1.42269 WP_000368338.1.4231 WP_000368338.1.42336 WP_000368338.1.42355 WP_000368338.1.42403 WP_000368338.1.42436 WP_000368338.1.42438 WP_000368338.1.42455 WP_000368338.1.42459 WP_000368338.1.42460 WP_000368338.1.42481 WP_000368338.1.42503 WP_000368338.1.42510 WP_000368338.1.42517 WP_000368338.1.42551 WP_000368338.1.42575 WP_000368338.1.42593 WP_000368338.1.42598 WP_000368338.1.426 WP_000368338.1.4260 WP_000368338.1.42640 WP_000368338.1.42652 WP_000368338.1.42667 WP_000368338.1.42668 WP_000368338.1.42674 WP_000368338.1.42706 WP_000368338.1.42737 WP_000368338.1.42738 WP_000368338.1.42740 WP_000368338.1.42759 WP_000368338.1.42786 WP_000368338.1.42802 WP_000368338.1.42819 WP_000368338.1.42837 WP_000368338.1.42848 WP_000368338.1.42893 WP_000368338.1.42924 WP_000368338.1.4293 WP_000368338.1.42982 WP_000368338.1.4299 WP_000368338.1.4300 WP_000368338.1.43014 WP_000368338.1.43020 WP_000368338.1.43033 WP_000368338.1.43047 WP_000368338.1.43072 WP_000368338.1.43114 WP_000368338.1.43122 WP_000368338.1.43131 WP_000368338.1.43134 WP_000368338.1.43143 WP_000368338.1.43147 WP_000368338.1.43159 WP_000368338.1.43165 WP_000368338.1.43200 WP_000368338.1.43202 WP_000368338.1.43206 WP_000368338.1.43220 WP_000368338.1.43225 WP_000368338.1.43232 WP_000368338.1.43248 WP_000368338.1.4325 WP_000368338.1.43263 WP_000368338.1.4327 WP_000368338.1.43274 WP_000368338.1.43323 WP_000368338.1.43325 WP_000368338.1.43328 WP_000368338.1.43341 WP_000368338.1.43349 WP_000368338.1.43366 WP_000368338.1.43369 WP_000368338.1.4337 WP_000368338.1.43383 WP_000368338.1.43406 WP_000368338.1.4341 WP_000368338.1.43410 WP_000368338.1.43414 WP_000368338.1.43460 WP_000368338.1.4347 WP_000368338.1.43506 WP_000368338.1.43530 WP_000368338.1.43550 WP_000368338.1.43560 WP_000368338.1.43573 WP_000368338.1.43594 WP_000368338.1.43600 WP_000368338.1.43617 WP_000368338.1.43618 WP_000368338.1.43627 WP_000368338.1.43659 WP_000368338.1.43670 WP_000368338.1.4369 WP_000368338.1.4370 WP_000368338.1.43702 WP_000368338.1.43703 WP_000368338.1.4372 WP_000368338.1.43731 WP_000368338.1.4374 WP_000368338.1.43752 WP_000368338.1.43788 WP_000368338.1.4379 WP_000368338.1.4380 WP_000368338.1.43800 WP_000368338.1.43819 WP_000368338.1.43822 WP_000368338.1.43827 WP_000368338.1.4385 WP_000368338.1.43851 WP_000368338.1.43904 WP_000368338.1.43915 WP_000368338.1.43924 WP_000368338.1.43988 WP_000368338.1.44021 WP_000368338.1.44072 WP_000368338.1.44095 WP_000368338.1.44119 WP_000368338.1.44150 WP_000368338.1.44153 WP_000368338.1.44181 WP_000368338.1.44186 WP_000368338.1.44195 WP_000368338.1.44255 WP_000368338.1.44265 WP_000368338.1.44302 WP_000368338.1.44312 WP_000368338.1.44331 WP_000368338.1.44388 WP_000368338.1.44396 WP_000368338.1.44405 WP_000368338.1.44420 WP_000368338.1.44455 WP_000368338.1.44480 WP_000368338.1.44493 WP_000368338.1.44536 WP_000368338.1.44544 WP_000368338.1.44547 WP_000368338.1.44579 WP_000368338.1.44588 WP_000368338.1.44605 WP_000368338.1.44631 WP_000368338.1.44646 WP_000368338.1.44672 WP_000368338.1.44674 WP_000368338.1.44732 WP_000368338.1.44755 WP_000368338.1.44768 WP_000368338.1.44785 WP_000368338.1.44788 WP_000368338.1.44796 WP_000368338.1.44802 WP_000368338.1.44853 WP_000368338.1.44881 WP_000368338.1.44882 WP_000368338.1.44891 WP_000368338.1.44899 WP_000368338.1.44903 WP_000368338.1.44914 WP_000368338.1.44932 WP_000368338.1.44948 WP_000368338.1.44955 WP_000368338.1.44969 WP_000368338.1.4499 WP_000368338.1.45008 WP_000368338.1.45015 WP_000368338.1.45033 WP_000368338.1.45035 WP_000368338.1.45099 WP_000368338.1.45101 WP_000368338.1.45111 WP_000368338.1.45114 WP_000368338.1.4513 WP_000368338.1.45131 WP_000368338.1.45133 WP_000368338.1.45164 WP_000368338.1.45170 WP_000368338.1.45188 WP_000368338.1.45189 WP_000368338.1.45218 WP_000368338.1.45221 WP_000368338.1.45272 WP_000368338.1.45290 WP_000368338.1.45297 WP_000368338.1.453 WP_000368338.1.45303 WP_000368338.1.45321 WP_000368338.1.45332 WP_000368338.1.45364 WP_000368338.1.45431 WP_000368338.1.45439 WP_000368338.1.45447 WP_000368338.1.45472 WP_000368338.1.45492 WP_000368338.1.4550 WP_000368338.1.45507 WP_000368338.1.45560 WP_000368338.1.45577 WP_000368338.1.45586 WP_000368338.1.45640 WP_000368338.1.45654 WP_000368338.1.45670 WP_000368338.1.45698 WP_000368338.1.45703 WP_000368338.1.45713 WP_000368338.1.45730 WP_000368338.1.45747 WP_000368338.1.45768 WP_000368338.1.45771 WP_000368338.1.45780 WP_000368338.1.4580 WP_000368338.1.45833 WP_000368338.1.4584 WP_000368338.1.45852 WP_000368338.1.45870 WP_000368338.1.45875 WP_000368338.1.45878 WP_000368338.1.45881 WP_000368338.1.45888 WP_000368338.1.45897 WP_000368338.1.459 WP_000368338.1.45954 WP_000368338.1.4598 WP_000368338.1.46003 WP_000368338.1.46005 WP_000368338.1.46013 WP_000368338.1.46021 WP_000368338.1.46055 WP_000368338.1.46071 WP_000368338.1.46082 WP_000368338.1.46106 WP_000368338.1.46109 WP_000368338.1.46136 WP_000368338.1.46168 WP_000368338.1.46195 WP_000368338.1.46208 WP_000368338.1.46212 WP_000368338.1.46222 WP_000368338.1.46228 WP_000368338.1.46259 WP_000368338.1.46276 WP_000368338.1.46289 WP_000368338.1.46330 WP_000368338.1.46334 WP_000368338.1.46362 WP_000368338.1.46368 WP_000368338.1.46380 WP_000368338.1.46389 WP_000368338.1.46401 WP_000368338.1.46418 WP_000368338.1.46422 WP_000368338.1.46457 WP_000368338.1.46465 WP_000368338.1.46488 WP_000368338.1.46528 WP_000368338.1.46534 WP_000368338.1.46543 WP_000368338.1.46576 WP_000368338.1.46587 WP_000368338.1.46608 WP_000368338.1.4662 WP_000368338.1.46660 WP_000368338.1.46664 WP_000368338.1.46670 WP_000368338.1.46688 WP_000368338.1.46692 WP_000368338.1.46696 WP_000368338.1.46703 WP_000368338.1.46752 WP_000368338.1.46765 WP_000368338.1.46767 WP_000368338.1.46823 WP_000368338.1.46837 WP_000368338.1.46852 WP_000368338.1.46875 WP_000368338.1.46881 WP_000368338.1.46908 WP_000368338.1.46911 WP_000368338.1.46925 WP_000368338.1.46937 WP_000368338.1.4696 WP_000368338.1.46964 WP_000368338.1.46965 WP_000368338.1.46983 WP_000368338.1.46995 WP_000368338.1.47051 WP_000368338.1.47090 WP_000368338.1.47105 WP_000368338.1.47128 WP_000368338.1.47153 WP_000368338.1.47159 WP_000368338.1.4716 WP_000368338.1.47163 WP_000368338.1.47187 WP_000368338.1.47211 WP_000368338.1.47216 WP_000368338.1.47218 WP_000368338.1.47250 WP_000368338.1.47258 WP_000368338.1.47269 WP_000368338.1.47276 WP_000368338.1.47279 WP_000368338.1.4728 WP_000368338.1.47290 WP_000368338.1.47294 WP_000368338.1.47308 WP_000368338.1.47317 WP_000368338.1.47328 WP_000368338.1.47353 WP_000368338.1.47381 WP_000368338.1.47383 WP_000368338.1.47399 WP_000368338.1.47405 WP_000368338.1.47406 WP_000368338.1.47422 WP_000368338.1.47426 WP_000368338.1.47432 WP_000368338.1.47439 WP_000368338.1.47450 WP_000368338.1.47493 WP_000368338.1.4752 WP_000368338.1.47530 WP_000368338.1.47541 WP_000368338.1.47554 WP_000368338.1.47560 WP_000368338.1.47561 WP_000368338.1.47570 WP_000368338.1.47577 WP_000368338.1.47618 WP_000368338.1.47629 WP_000368338.1.47667 WP_000368338.1.4767 WP_000368338.1.477 WP_000368338.1.47719 WP_000368338.1.47733 WP_000368338.1.47763 WP_000368338.1.47782 WP_000368338.1.47792 WP_000368338.1.47821 WP_000368338.1.47836 WP_000368338.1.47859 WP_000368338.1.47872 WP_000368338.1.47873 WP_000368338.1.47888 WP_000368338.1.47901 WP_000368338.1.47904 WP_000368338.1.47951 WP_000368338.1.47980 WP_000368338.1.47989 WP_000368338.1.47996 WP_000368338.1.48009 WP_000368338.1.48011 WP_000368338.1.48017 WP_000368338.1.48030 WP_000368338.1.48047 WP_000368338.1.4805 WP_000368338.1.48149 WP_000368338.1.4815 WP_000368338.1.48154 WP_000368338.1.48169 WP_000368338.1.48197 WP_000368338.1.48199 WP_000368338.1.48205 WP_000368338.1.48212 WP_000368338.1.48227 WP_000368338.1.48236 WP_000368338.1.48250 WP_000368338.1.48284 WP_000368338.1.48293 WP_000368338.1.48307 WP_000368338.1.48322 WP_000368338.1.48326 WP_000368338.1.48364 WP_000368338.1.48394 WP_000368338.1.484 WP_000368338.1.48425 WP_000368338.1.48463 WP_000368338.1.48492 WP_000368338.1.48556 WP_000368338.1.48563 WP_000368338.1.48577 WP_000368338.1.48593 WP_000368338.1.48601 WP_000368338.1.48634 WP_000368338.1.48655 WP_000368338.1.48656 WP_000368338.1.4868 WP_000368338.1.48694 WP_000368338.1.48705 WP_000368338.1.48711 WP_000368338.1.48775 WP_000368338.1.48786 WP_000368338.1.48817 WP_000368338.1.48818 WP_000368338.1.48823 WP_000368338.1.48833 WP_000368338.1.48835 WP_000368338.1.4886 WP_000368338.1.48936 WP_000368338.1.48941 WP_000368338.1.48943 WP_000368338.1.48945 WP_000368338.1.48951 WP_000368338.1.48966 WP_000368338.1.48968 WP_000368338.1.48982 WP_000368338.1.48993 WP_000368338.1.48996 WP_000368338.1.4901 WP_000368338.1.49032 WP_000368338.1.4905 WP_000368338.1.49129 WP_000368338.1.49150 WP_000368338.1.49154 WP_000368338.1.49159 WP_000368338.1.4916 WP_000368338.1.49161 WP_000368338.1.4917 WP_000368338.1.49173 WP_000368338.1.4918 WP_000368338.1.4920 WP_000368338.1.49207 WP_000368338.1.4921 WP_000368338.1.49227 WP_000368338.1.49234 WP_000368338.1.49248 WP_000368338.1.49327 WP_000368338.1.49330 WP_000368338.1.49367 WP_000368338.1.49373 WP_000368338.1.49398 WP_000368338.1.49444 WP_000368338.1.49479 WP_000368338.1.49484 WP_000368338.1.4950 WP_000368338.1.49573 WP_000368338.1.49605 WP_000368338.1.4962 WP_000368338.1.49653 WP_000368338.1.49658 WP_000368338.1.49669 WP_000368338.1.49671 WP_000368338.1.49704 WP_000368338.1.49707 WP_000368338.1.49715 WP_000368338.1.49730 WP_000368338.1.49742 WP_000368338.1.49757 WP_000368338.1.4980 WP_000368338.1.49800 WP_000368338.1.49825 WP_000368338.1.4984 WP_000368338.1.49863 WP_000368338.1.4987 WP_000368338.1.49871 WP_000368338.1.4989 WP_000368338.1.49894 WP_000368338.1.49907 WP_000368338.1.49912 WP_000368338.1.49913 WP_000368338.1.49917 WP_000368338.1.49921 WP_000368338.1.49934 WP_000368338.1.49936 WP_000368338.1.4994 WP_000368338.1.49943 WP_000368338.1.49951 WP_000368338.1.49970 WP_000368338.1.49982 WP_000368338.1.50013 WP_000368338.1.50015 WP_000368338.1.50023 WP_000368338.1.50038 WP_000368338.1.50039 WP_000368338.1.50061 WP_000368338.1.50064 WP_000368338.1.50071 WP_000368338.1.50076 WP_000368338.1.5013 WP_000368338.1.50138 WP_000368338.1.50175 WP_000368338.1.50217 WP_000368338.1.50219 WP_000368338.1.50229 WP_000368338.1.50261 WP_000368338.1.50313 WP_000368338.1.50314 WP_000368338.1.5035 WP_000368338.1.50356 WP_000368338.1.50360 WP_000368338.1.50377 WP_000368338.1.50424 WP_000368338.1.50425 WP_000368338.1.50430 WP_000368338.1.50431 WP_000368338.1.50440 WP_000368338.1.50477 WP_000368338.1.50516 WP_000368338.1.50527 WP_000368338.1.50536 WP_000368338.1.50543 WP_000368338.1.50555 WP_000368338.1.50556 WP_000368338.1.50578 WP_000368338.1.50595 WP_000368338.1.50660 WP_000368338.1.50669 WP_000368338.1.50732 WP_000368338.1.50742 WP_000368338.1.50745 WP_000368338.1.50748 WP_000368338.1.50759 WP_000368338.1.50768 WP_000368338.1.50799 WP_000368338.1.5080 WP_000368338.1.50820 WP_000368338.1.50827 WP_000368338.1.50884 WP_000368338.1.50896 WP_000368338.1.50937 WP_000368338.1.50958 WP_000368338.1.50962 WP_000368338.1.51008 WP_000368338.1.51031 WP_000368338.1.51062 WP_000368338.1.51085 WP_000368338.1.5109 WP_000368338.1.5110 WP_000368338.1.5111 WP_000368338.1.51138 WP_000368338.1.51152 WP_000368338.1.5117 WP_000368338.1.51194 WP_000368338.1.51220 WP_000368338.1.51236 WP_000368338.1.51245 WP_000368338.1.51250 WP_000368338.1.51282 WP_000368338.1.51295 WP_000368338.1.51306 WP_000368338.1.51310 WP_000368338.1.51346 WP_000368338.1.51376 WP_000368338.1.51377 WP_000368338.1.51403 WP_000368338.1.51418 WP_000368338.1.5145 WP_000368338.1.51454 WP_000368338.1.51456 WP_000368338.1.51465 WP_000368338.1.51469 WP_000368338.1.51492 WP_000368338.1.515 WP_000368338.1.51527 WP_000368338.1.5155 WP_000368338.1.51558 WP_000368338.1.51559 WP_000368338.1.51571 WP_000368338.1.51575 WP_000368338.1.51590 WP_000368338.1.51619 WP_000368338.1.51623 WP_000368338.1.51657 WP_000368338.1.51665 WP_000368338.1.51672 WP_000368338.1.51702 WP_000368338.1.51713 WP_000368338.1.51716 WP_000368338.1.51748 WP_000368338.1.51751 WP_000368338.1.51787 WP_000368338.1.51797 WP_000368338.1.51812 WP_000368338.1.51836 WP_000368338.1.51842 WP_000368338.1.51844 WP_000368338.1.51866 WP_000368338.1.51871 WP_000368338.1.51883 WP_000368338.1.5190 WP_000368338.1.51920 WP_000368338.1.51924 WP_000368338.1.51936 WP_000368338.1.51952 WP_000368338.1.51971 WP_000368338.1.51973 WP_000368338.1.51995 WP_000368338.1.52078 WP_000368338.1.5209 WP_000368338.1.521 WP_000368338.1.5213 WP_000368338.1.52151 WP_000368338.1.52162 WP_000368338.1.52182 WP_000368338.1.52185 WP_000368338.1.52193 WP_000368338.1.52224 WP_000368338.1.52251 WP_000368338.1.52252 WP_000368338.1.52259 WP_000368338.1.5228 WP_000368338.1.52296 WP_000368338.1.523 WP_000368338.1.52322 WP_000368338.1.52327 WP_000368338.1.52331 WP_000368338.1.52423 WP_000368338.1.52436 WP_000368338.1.52440 WP_000368338.1.52442 WP_000368338.1.52463 WP_000368338.1.52464 WP_000368338.1.52474 WP_000368338.1.52518 WP_000368338.1.52536 WP_000368338.1.52548 WP_000368338.1.52595 WP_000368338.1.52602 WP_000368338.1.52622 WP_000368338.1.52623 WP_000368338.1.52624 WP_000368338.1.52645 WP_000368338.1.52660 WP_000368338.1.52687 WP_000368338.1.52699 WP_000368338.1.52715 WP_000368338.1.52722 WP_000368338.1.52751 WP_000368338.1.52754 WP_000368338.1.52772 WP_000368338.1.52820 WP_000368338.1.52828 WP_000368338.1.52836 WP_000368338.1.52838 WP_000368338.1.52865 WP_000368338.1.52877 WP_000368338.1.52878 WP_000368338.1.52886 WP_000368338.1.52893 WP_000368338.1.52904 WP_000368338.1.52941 WP_000368338.1.52947 WP_000368338.1.52984 WP_000368338.1.52992 WP_000368338.1.53002 WP_000368338.1.53007 WP_000368338.1.53022 WP_000368338.1.53060 WP_000368338.1.53069 WP_000368338.1.53071 WP_000368338.1.53077 WP_000368338.1.53109 WP_000368338.1.53140 WP_000368338.1.53153 WP_000368338.1.53189 WP_000368338.1.53209 WP_000368338.1.5321 WP_000368338.1.5323 WP_000368338.1.53260 WP_000368338.1.53285 WP_000368338.1.53317 WP_000368338.1.53319 WP_000368338.1.53323 WP_000368338.1.53352 WP_000368338.1.5336 WP_000368338.1.53366 WP_000368338.1.53383 WP_000368338.1.53387 WP_000368338.1.53394 WP_000368338.1.53418 WP_000368338.1.53432 WP_000368338.1.53433 WP_000368338.1.53444 WP_000368338.1.53462 WP_000368338.1.53488 WP_000368338.1.53503 WP_000368338.1.53521 WP_000368338.1.53577 WP_000368338.1.5359 WP_000368338.1.53641 WP_000368338.1.53648 WP_000368338.1.53661 WP_000368338.1.53671 WP_000368338.1.53682 WP_000368338.1.53712 WP_000368338.1.53714 WP_000368338.1.53758 WP_000368338.1.53759 WP_000368338.1.53763 WP_000368338.1.53766 WP_000368338.1.53786 WP_000368338.1.5382 WP_000368338.1.53827 WP_000368338.1.53835 WP_000368338.1.53886 WP_000368338.1.53889 WP_000368338.1.53915 WP_000368338.1.53924 WP_000368338.1.53934 WP_000368338.1.53969 WP_000368338.1.53999 WP_000368338.1.5401 WP_000368338.1.54022 WP_000368338.1.54029 WP_000368338.1.54048 WP_000368338.1.54094 WP_000368338.1.54105 WP_000368338.1.54135 WP_000368338.1.54147 WP_000368338.1.54199 WP_000368338.1.54229 WP_000368338.1.54246 WP_000368338.1.54253 WP_000368338.1.54269 WP_000368338.1.54282 WP_000368338.1.54297 WP_000368338.1.54332 WP_000368338.1.54373 WP_000368338.1.54395 WP_000368338.1.544 WP_000368338.1.54413 WP_000368338.1.54426 WP_000368338.1.54446 WP_000368338.1.54477 WP_000368338.1.54503 WP_000368338.1.54510 WP_000368338.1.54518 WP_000368338.1.54539 WP_000368338.1.54551 WP_000368338.1.54572 WP_000368338.1.54637 WP_000368338.1.54675 WP_000368338.1.5469 WP_000368338.1.54728 WP_000368338.1.54733 WP_000368338.1.54745 WP_000368338.1.54753 WP_000368338.1.54819 WP_000368338.1.54826 WP_000368338.1.54847 WP_000368338.1.54878 WP_000368338.1.54895 WP_000368338.1.54914 WP_000368338.1.54955 WP_000368338.1.54995 WP_000368338.1.55014 WP_000368338.1.55090 WP_000368338.1.55100 WP_000368338.1.5519 WP_000368338.1.55192 WP_000368338.1.55214 WP_000368338.1.55220 WP_000368338.1.55274 WP_000368338.1.55301 WP_000368338.1.55306 WP_000368338.1.55309 WP_000368338.1.55352 WP_000368338.1.55353 WP_000368338.1.5536 WP_000368338.1.55367 WP_000368338.1.55369 WP_000368338.1.55403 WP_000368338.1.55405 WP_000368338.1.55421 WP_000368338.1.55442 WP_000368338.1.55508 WP_000368338.1.55538 WP_000368338.1.5554 WP_000368338.1.55544 WP_000368338.1.55558 WP_000368338.1.5556 WP_000368338.1.55573 WP_000368338.1.55583 WP_000368338.1.5559 WP_000368338.1.55620 WP_000368338.1.55628 WP_000368338.1.5565 WP_000368338.1.55653 WP_000368338.1.55657 WP_000368338.1.557 WP_000368338.1.55728 WP_000368338.1.55746 WP_000368338.1.5575 WP_000368338.1.55784 WP_000368338.1.55786 WP_000368338.1.5580 WP_000368338.1.55818 WP_000368338.1.55831 WP_000368338.1.55835 WP_000368338.1.55839 WP_000368338.1.55848 WP_000368338.1.55854 WP_000368338.1.55859 WP_000368338.1.55867 WP_000368338.1.55874 WP_000368338.1.55886 WP_000368338.1.5589 WP_000368338.1.5590 WP_000368338.1.55904 WP_000368338.1.55916 WP_000368338.1.55933 WP_000368338.1.55953 WP_000368338.1.55960 WP_000368338.1.55985 WP_000368338.1.55991 WP_000368338.1.56000 WP_000368338.1.56025 WP_000368338.1.56039 WP_000368338.1.56048 WP_000368338.1.56078 WP_000368338.1.56098 WP_000368338.1.56099 WP_000368338.1.56153 WP_000368338.1.56210 WP_000368338.1.56213 WP_000368338.1.56214 WP_000368338.1.56225 WP_000368338.1.5623 WP_000368338.1.56239 WP_000368338.1.56241 WP_000368338.1.56260 WP_000368338.1.56272 WP_000368338.1.56275 WP_000368338.1.56281 WP_000368338.1.56306 WP_000368338.1.56332 WP_000368338.1.56333 WP_000368338.1.56343 WP_000368338.1.5635 WP_000368338.1.56364 WP_000368338.1.5637 WP_000368338.1.56400 WP_000368338.1.5644 WP_000368338.1.56453 WP_000368338.1.56496 WP_000368338.1.56522 WP_000368338.1.56525 WP_000368338.1.56530 WP_000368338.1.56558 WP_000368338.1.56570 WP_000368338.1.5658 WP_000368338.1.56598 WP_000368338.1.566 WP_000368338.1.56628 WP_000368338.1.56641 WP_000368338.1.5665 WP_000368338.1.56658 WP_000368338.1.5666 WP_000368338.1.56679 WP_000368338.1.56696 WP_000368338.1.56722 WP_000368338.1.56723 WP_000368338.1.5677 WP_000368338.1.56778 WP_000368338.1.56794 WP_000368338.1.56803 WP_000368338.1.56806 WP_000368338.1.56815 WP_000368338.1.56856 WP_000368338.1.5686 WP_000368338.1.56865 WP_000368338.1.56878 WP_000368338.1.569 WP_000368338.1.56967 WP_000368338.1.56986 WP_000368338.1.57024 WP_000368338.1.57047 WP_000368338.1.57073 WP_000368338.1.57075 WP_000368338.1.57097 WP_000368338.1.57102 WP_000368338.1.57109 WP_000368338.1.57158 WP_000368338.1.57170 WP_000368338.1.57175 WP_000368338.1.5718 WP_000368338.1.57190 WP_000368338.1.57196 WP_000368338.1.57214 WP_000368338.1.57223 WP_000368338.1.57265 WP_000368338.1.57271 WP_000368338.1.57291 WP_000368338.1.57309 WP_000368338.1.57316 WP_000368338.1.57338 WP_000368338.1.5735 WP_000368338.1.57370 WP_000368338.1.57376 WP_000368338.1.57385 WP_000368338.1.57389 WP_000368338.1.5743 WP_000368338.1.57445 WP_000368338.1.57459 WP_000368338.1.57481 WP_000368338.1.57507 WP_000368338.1.5752 WP_000368338.1.57577 WP_000368338.1.57594 WP_000368338.1.57612 WP_000368338.1.57614 WP_000368338.1.5763 WP_000368338.1.57635 WP_000368338.1.57650 WP_000368338.1.57665 WP_000368338.1.57682 WP_000368338.1.57692 WP_000368338.1.5770 WP_000368338.1.57720 WP_000368338.1.57723 WP_000368338.1.57734 WP_000368338.1.57754 WP_000368338.1.57761 WP_000368338.1.57770 WP_000368338.1.57808 WP_000368338.1.57819 WP_000368338.1.57837 WP_000368338.1.57840 WP_000368338.1.57861 WP_000368338.1.57875 WP_000368338.1.57878 WP_000368338.1.57883 WP_000368338.1.57888 WP_000368338.1.579 WP_000368338.1.5791 WP_000368338.1.57910 WP_000368338.1.57915 WP_000368338.1.57928 WP_000368338.1.57943 WP_000368338.1.57944 WP_000368338.1.57952 WP_000368338.1.57974 WP_000368338.1.58005 WP_000368338.1.58014 WP_000368338.1.58016 WP_000368338.1.58017 WP_000368338.1.58035 WP_000368338.1.58042 WP_000368338.1.58049 WP_000368338.1.58050 WP_000368338.1.58074 WP_000368338.1.58106 WP_000368338.1.58116 WP_000368338.1.58127 WP_000368338.1.58139 WP_000368338.1.58148 WP_000368338.1.58158 WP_000368338.1.5816 WP_000368338.1.58175 WP_000368338.1.58212 WP_000368338.1.58242 WP_000368338.1.5827 WP_000368338.1.58277 WP_000368338.1.58317 WP_000368338.1.5832 WP_000368338.1.58352 WP_000368338.1.58364 WP_000368338.1.58388 WP_000368338.1.58395 WP_000368338.1.58413 WP_000368338.1.58419 WP_000368338.1.58430 WP_000368338.1.58473 WP_000368338.1.58497 WP_000368338.1.58504 WP_000368338.1.58512 WP_000368338.1.58530 WP_000368338.1.58538 WP_000368338.1.58549 WP_000368338.1.5857 WP_000368338.1.58571 WP_000368338.1.58584 WP_000368338.1.58588 WP_000368338.1.58592 WP_000368338.1.58598 WP_000368338.1.58626 WP_000368338.1.58686 WP_000368338.1.58701 WP_000368338.1.58704 WP_000368338.1.58718 WP_000368338.1.58735 WP_000368338.1.58760 WP_000368338.1.58763 WP_000368338.1.58772 WP_000368338.1.58798 WP_000368338.1.5880 WP_000368338.1.58833 WP_000368338.1.58839 WP_000368338.1.58860 WP_000368338.1.58934 WP_000368338.1.58960 WP_000368338.1.58981 WP_000368338.1.58991 WP_000368338.1.59011 WP_000368338.1.59014 WP_000368338.1.59039 WP_000368338.1.59046 WP_000368338.1.59062 WP_000368338.1.59077 WP_000368338.1.59124 WP_000368338.1.59135 WP_000368338.1.59146 WP_000368338.1.59157 WP_000368338.1.59175 WP_000368338.1.59178 WP_000368338.1.59187 WP_000368338.1.5920 WP_000368338.1.59203 WP_000368338.1.59213 WP_000368338.1.5930 WP_000368338.1.59311 WP_000368338.1.59329 WP_000368338.1.59334 WP_000368338.1.5938 WP_000368338.1.59380 WP_000368338.1.59398 WP_000368338.1.5940 WP_000368338.1.59401 WP_000368338.1.59404 WP_000368338.1.59414 WP_000368338.1.59441 WP_000368338.1.59462 WP_000368338.1.59464 WP_000368338.1.59498 WP_000368338.1.59540 WP_000368338.1.59546 WP_000368338.1.59547 WP_000368338.1.59567 WP_000368338.1.59594 WP_000368338.1.59598 WP_000368338.1.59643 WP_000368338.1.59668 WP_000368338.1.59669 WP_000368338.1.59671 WP_000368338.1.5972 WP_000368338.1.59736 WP_000368338.1.59787 WP_000368338.1.59810 WP_000368338.1.59819 WP_000368338.1.5982 WP_000368338.1.59822 WP_000368338.1.59864 WP_000368338.1.59874 WP_000368338.1.59896 WP_000368338.1.59907 WP_000368338.1.59915 WP_000368338.1.59921 WP_000368338.1.60001 WP_000368338.1.60006 WP_000368338.1.6006 WP_000368338.1.60101 WP_000368338.1.60107 WP_000368338.1.6011 WP_000368338.1.60118 WP_000368338.1.60123 WP_000368338.1.60124 WP_000368338.1.60147 WP_000368338.1.60149 WP_000368338.1.60157 WP_000368338.1.60158 WP_000368338.1.60165 WP_000368338.1.6017 WP_000368338.1.602 WP_000368338.1.60227 WP_000368338.1.60289 WP_000368338.1.60302 WP_000368338.1.60339 WP_000368338.1.6034 WP_000368338.1.60345 WP_000368338.1.60353 WP_000368338.1.60355 WP_000368338.1.60360 WP_000368338.1.60382 WP_000368338.1.60414 WP_000368338.1.60434 WP_000368338.1.6045 WP_000368338.1.60473 WP_000368338.1.60492 WP_000368338.1.60493 WP_000368338.1.60530 WP_000368338.1.60547 WP_000368338.1.60585 WP_000368338.1.60595 WP_000368338.1.60636 WP_000368338.1.60641 WP_000368338.1.60675 WP_000368338.1.60677 WP_000368338.1.60704 WP_000368338.1.60719 WP_000368338.1.60730 WP_000368338.1.60734 WP_000368338.1.60742 WP_000368338.1.60750 WP_000368338.1.60751 WP_000368338.1.60758 WP_000368338.1.60759 WP_000368338.1.60765 WP_000368338.1.60778 WP_000368338.1.60813 WP_000368338.1.60820 WP_000368338.1.60845 WP_000368338.1.6085 WP_000368338.1.60859 WP_000368338.1.60869 WP_000368338.1.60888 WP_000368338.1.60912 WP_000368338.1.60917 WP_000368338.1.60923 WP_000368338.1.60934 WP_000368338.1.60943 WP_000368338.1.60948 WP_000368338.1.60949 WP_000368338.1.60965 WP_000368338.1.60982 WP_000368338.1.60991 WP_000368338.1.61009 WP_000368338.1.61013 WP_000368338.1.61019 WP_000368338.1.61023 WP_000368338.1.61026 WP_000368338.1.61029 WP_000368338.1.61031 WP_000368338.1.61077 WP_000368338.1.61082 WP_000368338.1.61115 WP_000368338.1.61139 WP_000368338.1.61187 WP_000368338.1.61189 WP_000368338.1.6119 WP_000368338.1.61215 WP_000368338.1.61224 WP_000368338.1.6123 WP_000368338.1.61261 WP_000368338.1.61263 WP_000368338.1.61271 WP_000368338.1.61277 WP_000368338.1.61286 WP_000368338.1.61289 WP_000368338.1.61313 WP_000368338.1.61316 WP_000368338.1.61318 WP_000368338.1.61346 WP_000368338.1.61353 WP_000368338.1.6136 WP_000368338.1.61375 WP_000368338.1.61393 WP_000368338.1.61394 WP_000368338.1.61430 WP_000368338.1.61439 WP_000368338.1.61440 WP_000368338.1.6149 WP_000368338.1.61515 WP_000368338.1.61534 WP_000368338.1.61555 WP_000368338.1.61564 WP_000368338.1.61585 WP_000368338.1.61597 WP_000368338.1.61615 WP_000368338.1.61639 WP_000368338.1.61641 WP_000368338.1.61653 WP_000368338.1.6166 WP_000368338.1.61687 WP_000368338.1.6170 WP_000368338.1.61705 WP_000368338.1.61709 WP_000368338.1.61713 WP_000368338.1.61747 WP_000368338.1.61749 WP_000368338.1.61776 WP_000368338.1.61800 WP_000368338.1.61802 WP_000368338.1.61838 WP_000368338.1.61843 WP_000368338.1.61864 WP_000368338.1.6188 WP_000368338.1.6189 WP_000368338.1.61897 WP_000368338.1.61899 WP_000368338.1.619 WP_000368338.1.61903 WP_000368338.1.61921 WP_000368338.1.61962 WP_000368338.1.61975 WP_000368338.1.61978 WP_000368338.1.62002 WP_000368338.1.6201 WP_000368338.1.62028 WP_000368338.1.62069 WP_000368338.1.62071 WP_000368338.1.6208 WP_000368338.1.62084 WP_000368338.1.62085 WP_000368338.1.62096 WP_000368338.1.62127 WP_000368338.1.62160 WP_000368338.1.62229 WP_000368338.1.62247 WP_000368338.1.62253 WP_000368338.1.62254 WP_000368338.1.62265 WP_000368338.1.62318 WP_000368338.1.6234 WP_000368338.1.62346 WP_000368338.1.62352 WP_000368338.1.62382 WP_000368338.1.62383 WP_000368338.1.62392 WP_000368338.1.62398 WP_000368338.1.62414 WP_000368338.1.62429 WP_000368338.1.62453 WP_000368338.1.62462 WP_000368338.1.62474 WP_000368338.1.62482 WP_000368338.1.62492 WP_000368338.1.62496 WP_000368338.1.6250 WP_000368338.1.62553 WP_000368338.1.62563 WP_000368338.1.62602 WP_000368338.1.62621 WP_000368338.1.62653 WP_000368338.1.6266 WP_000368338.1.62671 WP_000368338.1.62674 WP_000368338.1.6268 WP_000368338.1.62684 WP_000368338.1.62723 WP_000368338.1.62771 WP_000368338.1.62822 WP_000368338.1.62824 WP_000368338.1.62831 WP_000368338.1.62863 WP_000368338.1.62880 WP_000368338.1.62925 WP_000368338.1.62927 WP_000368338.1.62970 WP_000368338.1.62974 WP_000368338.1.6298 WP_000368338.1.62998 WP_000368338.1.63003 WP_000368338.1.63004 WP_000368338.1.63021 WP_000368338.1.63027 WP_000368338.1.63040 WP_000368338.1.63051 WP_000368338.1.63052 WP_000368338.1.63062 WP_000368338.1.63070 WP_000368338.1.63083 WP_000368338.1.63085 WP_000368338.1.63107 WP_000368338.1.63120 WP_000368338.1.63131 WP_000368338.1.63139 WP_000368338.1.63140 WP_000368338.1.63142 WP_000368338.1.63143 WP_000368338.1.63162 WP_000368338.1.63170 WP_000368338.1.63190 WP_000368338.1.63220 WP_000368338.1.63228 WP_000368338.1.63255 WP_000368338.1.63266 WP_000368338.1.63280 WP_000368338.1.63288 WP_000368338.1.63289 WP_000368338.1.63304 WP_000368338.1.63313 WP_000368338.1.63322 WP_000368338.1.63333 WP_000368338.1.63341 WP_000368338.1.63364 WP_000368338.1.63365 WP_000368338.1.63441 WP_000368338.1.63469 WP_000368338.1.63471 WP_000368338.1.63540 WP_000368338.1.6355 WP_000368338.1.63589 WP_000368338.1.63635 WP_000368338.1.63672 WP_000368338.1.63673 WP_000368338.1.63678 WP_000368338.1.63704 WP_000368338.1.63726 WP_000368338.1.63729 WP_000368338.1.6374 WP_000368338.1.63751 WP_000368338.1.63759 WP_000368338.1.63760 WP_000368338.1.63763 WP_000368338.1.63774 WP_000368338.1.63828 WP_000368338.1.63874 WP_000368338.1.63878 WP_000368338.1.6388 WP_000368338.1.63890 WP_000368338.1.63895 WP_000368338.1.63907 WP_000368338.1.63910 WP_000368338.1.63937 WP_000368338.1.63947 WP_000368338.1.63978 WP_000368338.1.63987 WP_000368338.1.63998 WP_000368338.1.6403 WP_000368338.1.64060 WP_000368338.1.6408 WP_000368338.1.6412 WP_000368338.1.64127 WP_000368338.1.64181 WP_000368338.1.64192 WP_000368338.1.642 WP_000368338.1.64230 WP_000368338.1.64232 WP_000368338.1.64234 WP_000368338.1.64250 WP_000368338.1.64279 WP_000368338.1.64288 WP_000368338.1.64304 WP_000368338.1.64334 WP_000368338.1.64351 WP_000368338.1.64367 WP_000368338.1.6438 WP_000368338.1.64396 WP_000368338.1.64397 WP_000368338.1.64408 WP_000368338.1.64434 WP_000368338.1.64440 WP_000368338.1.64446 WP_000368338.1.64457 WP_000368338.1.64473 WP_000368338.1.645 WP_000368338.1.64525 WP_000368338.1.6453 WP_000368338.1.64537 WP_000368338.1.64549 WP_000368338.1.64565 WP_000368338.1.64583 WP_000368338.1.6459 WP_000368338.1.6462 WP_000368338.1.64631 WP_000368338.1.64677 WP_000368338.1.64686 WP_000368338.1.64720 WP_000368338.1.64765 WP_000368338.1.6479 WP_000368338.1.64858 WP_000368338.1.64873 WP_000368338.1.64879 WP_000368338.1.6488 WP_000368338.1.64893 WP_000368338.1.64896 WP_000368338.1.64897 WP_000368338.1.64899 WP_000368338.1.64911 WP_000368338.1.64928 WP_000368338.1.64935 WP_000368338.1.64961 WP_000368338.1.64988 WP_000368338.1.64994 WP_000368338.1.65044 WP_000368338.1.65046 WP_000368338.1.65082 WP_000368338.1.6509 WP_000368338.1.65125 WP_000368338.1.65132 WP_000368338.1.65153 WP_000368338.1.65156 WP_000368338.1.65158 WP_000368338.1.65164 WP_000368338.1.65180 WP_000368338.1.65193 WP_000368338.1.65203 WP_000368338.1.65214 WP_000368338.1.65217 WP_000368338.1.65243 WP_000368338.1.65259 WP_000368338.1.65274 WP_000368338.1.6531 WP_000368338.1.65317 WP_000368338.1.65346 WP_000368338.1.65361 WP_000368338.1.65367 WP_000368338.1.65419 WP_000368338.1.65423 WP_000368338.1.65432 WP_000368338.1.65443 WP_000368338.1.65451 WP_000368338.1.6547 WP_000368338.1.65470 WP_000368338.1.65504 WP_000368338.1.6551 WP_000368338.1.65512 WP_000368338.1.65520 WP_000368338.1.65541 WP_000368338.1.65544 WP_000368338.1.65555 WP_000368338.1.65562 WP_000368338.1.6559 WP_000368338.1.65599 WP_000368338.1.65600 WP_000368338.1.65653 WP_000368338.1.65663 WP_000368338.1.65675 WP_000368338.1.65689 WP_000368338.1.65693 WP_000368338.1.65700 WP_000368338.1.65703 WP_000368338.1.65704 WP_000368338.1.65705 WP_000368338.1.65717 WP_000368338.1.65750 WP_000368338.1.65752 WP_000368338.1.6578 WP_000368338.1.65808 WP_000368338.1.65842 WP_000368338.1.65856 WP_000368338.1.65870 WP_000368338.1.65879 WP_000368338.1.65886 WP_000368338.1.65922 WP_000368338.1.65928 WP_000368338.1.65931 WP_000368338.1.65946 WP_000368338.1.65986 WP_000368338.1.65990 WP_000368338.1.66009 WP_000368338.1.66014 WP_000368338.1.66035 WP_000368338.1.66056 WP_000368338.1.66081 WP_000368338.1.661 WP_000368338.1.6612 WP_000368338.1.66120 WP_000368338.1.66133 WP_000368338.1.66175 WP_000368338.1.66227 WP_000368338.1.66262 WP_000368338.1.66281 WP_000368338.1.66287 WP_000368338.1.66302 WP_000368338.1.66322 WP_000368338.1.66328 WP_000368338.1.66369 WP_000368338.1.66433 WP_000368338.1.66505 WP_000368338.1.66518 WP_000368338.1.66519 WP_000368338.1.66542 WP_000368338.1.66554 WP_000368338.1.66564 WP_000368338.1.66576 WP_000368338.1.66588 WP_000368338.1.66601 WP_000368338.1.66606 WP_000368338.1.66628 WP_000368338.1.66645 WP_000368338.1.66655 WP_000368338.1.66664 WP_000368338.1.66677 WP_000368338.1.6668 WP_000368338.1.66690 WP_000368338.1.66711 WP_000368338.1.66712 WP_000368338.1.66726 WP_000368338.1.6674 WP_000368338.1.66765 WP_000368338.1.66786 WP_000368338.1.66792 WP_000368338.1.66818 WP_000368338.1.6684 WP_000368338.1.66853 WP_000368338.1.66904 WP_000368338.1.66906 WP_000368338.1.66979 WP_000368338.1.66996 WP_000368338.1.67006 WP_000368338.1.67016 WP_000368338.1.67063 WP_000368338.1.67090 WP_000368338.1.67112 WP_000368338.1.67135 WP_000368338.1.67152 WP_000368338.1.67191 WP_000368338.1.67204 WP_000368338.1.67212 WP_000368338.1.6722 WP_000368338.1.67266 WP_000368338.1.67296 WP_000368338.1.67297 WP_000368338.1.67329 WP_000368338.1.67333 WP_000368338.1.67375 WP_000368338.1.67379 WP_000368338.1.67384 WP_000368338.1.67386 WP_000368338.1.6740 WP_000368338.1.67414 WP_000368338.1.67447 WP_000368338.1.67463 WP_000368338.1.67480 WP_000368338.1.67505 WP_000368338.1.67507 WP_000368338.1.67513 WP_000368338.1.67520 WP_000368338.1.67521 WP_000368338.1.67554 WP_000368338.1.67572 WP_000368338.1.67609 WP_000368338.1.67612 WP_000368338.1.67618 WP_000368338.1.67620 WP_000368338.1.67632 WP_000368338.1.67651 WP_000368338.1.67652 WP_000368338.1.67703 WP_000368338.1.67712 WP_000368338.1.67713 WP_000368338.1.67722 WP_000368338.1.67752 WP_000368338.1.67754 WP_000368338.1.67762 WP_000368338.1.67767 WP_000368338.1.67798 WP_000368338.1.67800 WP_000368338.1.67808 WP_000368338.1.67815 WP_000368338.1.6786 WP_000368338.1.67864 WP_000368338.1.67865 WP_000368338.1.67889 WP_000368338.1.67925 WP_000368338.1.67931 WP_000368338.1.67941 WP_000368338.1.67986 WP_000368338.1.68001 WP_000368338.1.68020 WP_000368338.1.68033 WP_000368338.1.68054 WP_000368338.1.68066 WP_000368338.1.68102 WP_000368338.1.6811 WP_000368338.1.68111 WP_000368338.1.68139 WP_000368338.1.68160 WP_000368338.1.68161 WP_000368338.1.68199 WP_000368338.1.68219 WP_000368338.1.68233 WP_000368338.1.68261 WP_000368338.1.68295 WP_000368338.1.6830 WP_000368338.1.68307 WP_000368338.1.68334 WP_000368338.1.6834 WP_000368338.1.68343 WP_000368338.1.68351 WP_000368338.1.68367 WP_000368338.1.6839 WP_000368338.1.68392 WP_000368338.1.68397 WP_000368338.1.68404 WP_000368338.1.68416 WP_000368338.1.68425 WP_000368338.1.68466 WP_000368338.1.68483 WP_000368338.1.68489 WP_000368338.1.68505 WP_000368338.1.68522 WP_000368338.1.68542 WP_000368338.1.68565 WP_000368338.1.68575 WP_000368338.1.68650 WP_000368338.1.68657 WP_000368338.1.68699 WP_000368338.1.68703 WP_000368338.1.68716 WP_000368338.1.68728 WP_000368338.1.68737 WP_000368338.1.68747 WP_000368338.1.68773 WP_000368338.1.68775 WP_000368338.1.68813 WP_000368338.1.68831 WP_000368338.1.68854 WP_000368338.1.68875 WP_000368338.1.68878 WP_000368338.1.68917 WP_000368338.1.68931 WP_000368338.1.68943 WP_000368338.1.68944 WP_000368338.1.68987 WP_000368338.1.68988 WP_000368338.1.69016 WP_000368338.1.69045 WP_000368338.1.69087 WP_000368338.1.69089 WP_000368338.1.69110 WP_000368338.1.69111 WP_000368338.1.69125 WP_000368338.1.69162 WP_000368338.1.6917 WP_000368338.1.69191 WP_000368338.1.69219 WP_000368338.1.69222 WP_000368338.1.69232 WP_000368338.1.69237 WP_000368338.1.69239 WP_000368338.1.69266 WP_000368338.1.69280 WP_000368338.1.69314 WP_000368338.1.69361 WP_000368338.1.69378 WP_000368338.1.69395 WP_000368338.1.69409 WP_000368338.1.69412 WP_000368338.1.69415 WP_000368338.1.69434 WP_000368338.1.69446 WP_000368338.1.69476 WP_000368338.1.69477 WP_000368338.1.69480 WP_000368338.1.69483 WP_000368338.1.69484 WP_000368338.1.69489 WP_000368338.1.695 WP_000368338.1.69520 WP_000368338.1.69552 WP_000368338.1.69559 WP_000368338.1.69563 WP_000368338.1.69622 WP_000368338.1.69639 WP_000368338.1.69679 WP_000368338.1.69685 WP_000368338.1.69718 WP_000368338.1.69721 WP_000368338.1.69842 WP_000368338.1.69877 WP_000368338.1.69878 WP_000368338.1.69921 WP_000368338.1.69987 WP_000368338.1.70024 WP_000368338.1.70048 WP_000368338.1.70089 WP_000368338.1.70094 WP_000368338.1.70105 WP_000368338.1.7012 WP_000368338.1.70133 WP_000368338.1.7024 WP_000368338.1.70253 WP_000368338.1.70266 WP_000368338.1.70273 WP_000368338.1.703 WP_000368338.1.7030 WP_000368338.1.70338 WP_000368338.1.7034 WP_000368338.1.70344 WP_000368338.1.70349 WP_000368338.1.70353 WP_000368338.1.70361 WP_000368338.1.70389 WP_000368338.1.70413 WP_000368338.1.7043 WP_000368338.1.70438 WP_000368338.1.70441 WP_000368338.1.70451 WP_000368338.1.70457 WP_000368338.1.70459 WP_000368338.1.70462 WP_000368338.1.7053 WP_000368338.1.70541 WP_000368338.1.70546 WP_000368338.1.70572 WP_000368338.1.706 WP_000368338.1.7061 WP_000368338.1.70611 WP_000368338.1.70635 WP_000368338.1.70641 WP_000368338.1.70651 WP_000368338.1.7067 WP_000368338.1.70672 WP_000368338.1.7071 WP_000368338.1.7073 WP_000368338.1.70790 WP_000368338.1.70791 WP_000368338.1.70807 WP_000368338.1.70818 WP_000368338.1.70823 WP_000368338.1.70850 WP_000368338.1.70855 WP_000368338.1.7089 WP_000368338.1.70917 WP_000368338.1.70924 WP_000368338.1.70930 WP_000368338.1.70943 WP_000368338.1.70994 WP_000368338.1.71027 WP_000368338.1.71043 WP_000368338.1.71058 WP_000368338.1.71059 WP_000368338.1.71073 WP_000368338.1.7109 WP_000368338.1.711 WP_000368338.1.71130 WP_000368338.1.71179 WP_000368338.1.71180 WP_000368338.1.71182 WP_000368338.1.7119 WP_000368338.1.71196 WP_000368338.1.7120 WP_000368338.1.71236 WP_000368338.1.71256 WP_000368338.1.71257 WP_000368338.1.71266 WP_000368338.1.71280 WP_000368338.1.71295 WP_000368338.1.71298 WP_000368338.1.71301 WP_000368338.1.71316 WP_000368338.1.71325 WP_000368338.1.71332 WP_000368338.1.71345 WP_000368338.1.71351 WP_000368338.1.71359 WP_000368338.1.71404 WP_000368338.1.71416 WP_000368338.1.71428 WP_000368338.1.71431 WP_000368338.1.71438 WP_000368338.1.71463 WP_000368338.1.71466 WP_000368338.1.71483 WP_000368338.1.7150 WP_000368338.1.71519 WP_000368338.1.71521 WP_000368338.1.71529 WP_000368338.1.71541 WP_000368338.1.71543 WP_000368338.1.71547 WP_000368338.1.71572 WP_000368338.1.71575 WP_000368338.1.7158 WP_000368338.1.71602 WP_000368338.1.7161 WP_000368338.1.7164 WP_000368338.1.71644 WP_000368338.1.71676 WP_000368338.1.71707 WP_000368338.1.71735 WP_000368338.1.71771 WP_000368338.1.71772 WP_000368338.1.71780 WP_000368338.1.71788 WP_000368338.1.71800 WP_000368338.1.71828 WP_000368338.1.71836 WP_000368338.1.71859 WP_000368338.1.71861 WP_000368338.1.71888 WP_000368338.1.71925 WP_000368338.1.7193 WP_000368338.1.71949 WP_000368338.1.7198 WP_000368338.1.71981 WP_000368338.1.71989 WP_000368338.1.72026 WP_000368338.1.72031 WP_000368338.1.72035 WP_000368338.1.72067 WP_000368338.1.72089 WP_000368338.1.72099 WP_000368338.1.72112 WP_000368338.1.72169 WP_000368338.1.72205 WP_000368338.1.72257 WP_000368338.1.72285 WP_000368338.1.72315 WP_000368338.1.72330 WP_000368338.1.72347 WP_000368338.1.7236 WP_000368338.1.72366 WP_000368338.1.7242 WP_000368338.1.72424 WP_000368338.1.72433 WP_000368338.1.72446 WP_000368338.1.72478 WP_000368338.1.72489 WP_000368338.1.72496 WP_000368338.1.72529 WP_000368338.1.72547 WP_000368338.1.72564 WP_000368338.1.72654 WP_000368338.1.72760 WP_000368338.1.7278 WP_000368338.1.72787 WP_000368338.1.72832 WP_000368338.1.72834 WP_000368338.1.72835 WP_000368338.1.72874 WP_000368338.1.72903 WP_000368338.1.72904 WP_000368338.1.7292 WP_000368338.1.72935 WP_000368338.1.7294 WP_000368338.1.72945 WP_000368338.1.72965 WP_000368338.1.73004 WP_000368338.1.73017 WP_000368338.1.73019 WP_000368338.1.73022 WP_000368338.1.73037 WP_000368338.1.73046 WP_000368338.1.73074 WP_000368338.1.73121 WP_000368338.1.73122 WP_000368338.1.73132 WP_000368338.1.73191 WP_000368338.1.73246 WP_000368338.1.7326 WP_000368338.1.73265 WP_000368338.1.73286 WP_000368338.1.73312 WP_000368338.1.73386 WP_000368338.1.73402 WP_000368338.1.73444 WP_000368338.1.73456 WP_000368338.1.73467 WP_000368338.1.73489 WP_000368338.1.73501 WP_000368338.1.73526 WP_000368338.1.73536 WP_000368338.1.73547 WP_000368338.1.73571 WP_000368338.1.73591 WP_000368338.1.736 WP_000368338.1.73639 WP_000368338.1.73640 WP_000368338.1.73685 WP_000368338.1.73687 WP_000368338.1.73693 WP_000368338.1.73733 WP_000368338.1.73735 WP_000368338.1.73736 WP_000368338.1.73786 WP_000368338.1.7380 WP_000368338.1.73834 WP_000368338.1.73837 WP_000368338.1.73853 WP_000368338.1.73858 WP_000368338.1.73880 WP_000368338.1.73910 WP_000368338.1.73920 WP_000368338.1.73961 WP_000368338.1.73969 WP_000368338.1.73976 WP_000368338.1.73983 WP_000368338.1.74006 WP_000368338.1.74010 WP_000368338.1.74013 WP_000368338.1.74025 WP_000368338.1.74027 WP_000368338.1.74081 WP_000368338.1.74088 WP_000368338.1.74138 WP_000368338.1.74157 WP_000368338.1.74158 WP_000368338.1.74161 WP_000368338.1.74173 WP_000368338.1.7418 WP_000368338.1.74183 WP_000368338.1.74187 WP_000368338.1.74201 WP_000368338.1.74216 WP_000368338.1.74221 WP_000368338.1.74234 WP_000368338.1.74237 WP_000368338.1.74242 WP_000368338.1.7427 WP_000368338.1.74273 WP_000368338.1.7428 WP_000368338.1.74338 WP_000368338.1.7434 WP_000368338.1.74353 WP_000368338.1.74356 WP_000368338.1.74380 WP_000368338.1.74390 WP_000368338.1.74429 WP_000368338.1.74457 WP_000368338.1.74474 WP_000368338.1.74486 WP_000368338.1.74497 WP_000368338.1.74510 WP_000368338.1.74533 WP_000368338.1.74556 WP_000368338.1.7457 WP_000368338.1.74587 WP_000368338.1.74590 WP_000368338.1.74610 WP_000368338.1.74638 WP_000368338.1.74645 WP_000368338.1.74693 WP_000368338.1.74696 WP_000368338.1.74704 WP_000368338.1.74731 WP_000368338.1.74747 WP_000368338.1.74761 WP_000368338.1.74775 WP_000368338.1.74781 WP_000368338.1.74802 WP_000368338.1.74808 WP_000368338.1.74840 WP_000368338.1.74849 WP_000368338.1.74866 WP_000368338.1.74890 WP_000368338.1.74899 WP_000368338.1.74911 WP_000368338.1.74922 WP_000368338.1.74961 WP_000368338.1.74963 WP_000368338.1.74978 WP_000368338.1.74985 WP_000368338.1.74994 WP_000368338.1.74999 WP_000368338.1.7500 WP_000368338.1.75006 WP_000368338.1.75038 WP_000368338.1.75044 WP_000368338.1.75048 WP_000368338.1.75052 WP_000368338.1.75091 WP_000368338.1.75122 WP_000368338.1.75127 WP_000368338.1.75186 WP_000368338.1.75227 WP_000368338.1.75252 WP_000368338.1.75253 WP_000368338.1.75294 WP_000368338.1.75298 WP_000368338.1.75304 WP_000368338.1.75320 WP_000368338.1.75327 WP_000368338.1.75349 WP_000368338.1.75365 WP_000368338.1.75369 WP_000368338.1.75375 WP_000368338.1.75379 WP_000368338.1.75399 WP_000368338.1.75411 WP_000368338.1.7542 WP_000368338.1.75438 WP_000368338.1.75440 WP_000368338.1.75481 WP_000368338.1.75506 WP_000368338.1.75509 WP_000368338.1.75521 WP_000368338.1.75527 WP_000368338.1.75542 WP_000368338.1.75551 WP_000368338.1.75590 WP_000368338.1.7561 WP_000368338.1.75623 WP_000368338.1.75649 WP_000368338.1.75652 WP_000368338.1.75680 WP_000368338.1.75685 WP_000368338.1.75704 WP_000368338.1.75769 WP_000368338.1.75770 WP_000368338.1.75775 WP_000368338.1.758 WP_000368338.1.75805 WP_000368338.1.75824 WP_000368338.1.75830 WP_000368338.1.7584 WP_000368338.1.75848 WP_000368338.1.75851 WP_000368338.1.75856 WP_000368338.1.75879 WP_000368338.1.75881 WP_000368338.1.75885 WP_000368338.1.75929 WP_000368338.1.75944 WP_000368338.1.75952 WP_000368338.1.75956 WP_000368338.1.7596 WP_000368338.1.76010 WP_000368338.1.76015 WP_000368338.1.7607 WP_000368338.1.76071 WP_000368338.1.76073 WP_000368338.1.76095 WP_000368338.1.76104 WP_000368338.1.76112 WP_000368338.1.76123 WP_000368338.1.76136 WP_000368338.1.76143 WP_000368338.1.76149 WP_000368338.1.76185 WP_000368338.1.76230 WP_000368338.1.76234 WP_000368338.1.7624 WP_000368338.1.7625 WP_000368338.1.76258 WP_000368338.1.76261 WP_000368338.1.76283 WP_000368338.1.76295 WP_000368338.1.76332 WP_000368338.1.76333 WP_000368338.1.76351 WP_000368338.1.7638 WP_000368338.1.76411 WP_000368338.1.76419 WP_000368338.1.76420 WP_000368338.1.76421 WP_000368338.1.76482 WP_000368338.1.76528 WP_000368338.1.76604 WP_000368338.1.76606 WP_000368338.1.76624 WP_000368338.1.76648 WP_000368338.1.76659 WP_000368338.1.76686 WP_000368338.1.76689 WP_000368338.1.76690 WP_000368338.1.76693 WP_000368338.1.7675 WP_000368338.1.76790 WP_000368338.1.76792 WP_000368338.1.768 WP_000368338.1.76816 WP_000368338.1.76820 WP_000368338.1.76839 WP_000368338.1.76845 WP_000368338.1.7686 WP_000368338.1.76867 WP_000368338.1.76869 WP_000368338.1.76872 WP_000368338.1.76876 WP_000368338.1.76878 WP_000368338.1.76895 WP_000368338.1.76897 WP_000368338.1.76920 WP_000368338.1.76921 WP_000368338.1.76944 WP_000368338.1.76952 WP_000368338.1.76998 WP_000368338.1.77013 WP_000368338.1.77020 WP_000368338.1.77027 WP_000368338.1.77031 WP_000368338.1.77041 WP_000368338.1.77050 WP_000368338.1.77060 WP_000368338.1.77062 WP_000368338.1.77069 WP_000368338.1.77112 WP_000368338.1.77144 WP_000368338.1.77145 WP_000368338.1.77183 WP_000368338.1.77256 WP_000368338.1.77259 WP_000368338.1.77305 WP_000368338.1.77354 WP_000368338.1.77416 WP_000368338.1.77426 WP_000368338.1.77446 WP_000368338.1.7745 WP_000368338.1.7746 WP_000368338.1.77460 WP_000368338.1.77489 WP_000368338.1.77497 WP_000368338.1.77520 WP_000368338.1.77527 WP_000368338.1.77533 WP_000368338.1.77536 WP_000368338.1.77572 WP_000368338.1.77583 WP_000368338.1.77603 WP_000368338.1.77606 WP_000368338.1.77674 WP_000368338.1.77738 WP_000368338.1.7774 WP_000368338.1.77743 WP_000368338.1.77745 WP_000368338.1.77763 WP_000368338.1.77805 WP_000368338.1.77814 WP_000368338.1.77818 WP_000368338.1.77822 WP_000368338.1.77827 WP_000368338.1.77832 WP_000368338.1.77848 WP_000368338.1.77858 WP_000368338.1.77860 WP_000368338.1.7787 WP_000368338.1.77883 WP_000368338.1.77896 WP_000368338.1.77908 WP_000368338.1.77957 WP_000368338.1.78002 WP_000368338.1.78050 WP_000368338.1.78054 WP_000368338.1.78067 WP_000368338.1.78091 WP_000368338.1.78116 WP_000368338.1.78126 WP_000368338.1.78173 WP_000368338.1.78185 WP_000368338.1.78189 WP_000368338.1.78207 WP_000368338.1.78210 WP_000368338.1.78252 WP_000368338.1.78254 WP_000368338.1.78257 WP_000368338.1.7827 WP_000368338.1.78311 WP_000368338.1.78324 WP_000368338.1.78332 WP_000368338.1.78365 WP_000368338.1.78404 WP_000368338.1.78458 WP_000368338.1.78478 WP_000368338.1.7850 WP_000368338.1.78513 WP_000368338.1.78550 WP_000368338.1.78558 WP_000368338.1.7857 WP_000368338.1.78582 WP_000368338.1.78596 WP_000368338.1.78598 WP_000368338.1.78604 WP_000368338.1.78625 WP_000368338.1.78633 WP_000368338.1.78638 WP_000368338.1.78653 WP_000368338.1.78667 WP_000368338.1.78708 WP_000368338.1.78728 WP_000368338.1.78731 WP_000368338.1.78785 WP_000368338.1.78803 WP_000368338.1.78819 WP_000368338.1.78841 WP_000368338.1.78872 WP_000368338.1.7888 WP_000368338.1.78897 WP_000368338.1.78934 WP_000368338.1.78946 WP_000368338.1.78978 WP_000368338.1.78983 WP_000368338.1.7900 WP_000368338.1.79006 WP_000368338.1.79037 WP_000368338.1.79038 WP_000368338.1.79051 WP_000368338.1.79059 WP_000368338.1.79085 WP_000368338.1.79114 WP_000368338.1.79131 WP_000368338.1.79132 WP_000368338.1.79156 WP_000368338.1.79170 WP_000368338.1.79197 WP_000368338.1.79208 WP_000368338.1.79223 WP_000368338.1.79244 WP_000368338.1.79270 WP_000368338.1.7930 WP_000368338.1.7931 WP_000368338.1.79310 WP_000368338.1.79314 WP_000368338.1.79320 WP_000368338.1.79322 WP_000368338.1.79332 WP_000368338.1.79334 WP_000368338.1.79341 WP_000368338.1.79367 WP_000368338.1.79374 WP_000368338.1.79379 WP_000368338.1.79400 WP_000368338.1.79407 WP_000368338.1.79436 WP_000368338.1.79452 WP_000368338.1.79461 WP_000368338.1.79473 WP_000368338.1.79476 WP_000368338.1.79487 WP_000368338.1.79539 WP_000368338.1.79543 WP_000368338.1.79554 WP_000368338.1.79556 WP_000368338.1.79566 WP_000368338.1.79626 WP_000368338.1.79646 WP_000368338.1.79662 WP_000368338.1.79672 WP_000368338.1.79706 WP_000368338.1.79737 WP_000368338.1.79810 WP_000368338.1.79822 WP_000368338.1.79831 WP_000368338.1.79834 WP_000368338.1.79837 WP_000368338.1.79854 WP_000368338.1.79855 WP_000368338.1.7989 WP_000368338.1.79896 WP_000368338.1.79911 WP_000368338.1.79919 WP_000368338.1.7992 WP_000368338.1.79941 WP_000368338.1.79961 WP_000368338.1.79971 WP_000368338.1.79991 WP_000368338.1.80000 WP_000368338.1.80032 WP_000368338.1.80034 WP_000368338.1.80042 WP_000368338.1.80079 WP_000368338.1.80109 WP_000368338.1.80124 WP_000368338.1.80127 WP_000368338.1.80147 WP_000368338.1.80152 WP_000368338.1.80159 WP_000368338.1.80181 WP_000368338.1.80193 WP_000368338.1.80203 WP_000368338.1.80206 WP_000368338.1.80286 WP_000368338.1.80287 WP_000368338.1.80290 WP_000368338.1.8030 WP_000368338.1.80303 WP_000368338.1.80308 WP_000368338.1.8031 WP_000368338.1.80317 WP_000368338.1.80318 WP_000368338.1.80345 WP_000368338.1.8035 WP_000368338.1.80358 WP_000368338.1.80378 WP_000368338.1.80393 WP_000368338.1.80407 WP_000368338.1.80414 WP_000368338.1.8043 WP_000368338.1.80430 WP_000368338.1.80472 WP_000368338.1.80482 WP_000368338.1.80530 WP_000368338.1.80647 WP_000368338.1.8065 WP_000368338.1.8066 WP_000368338.1.80680 WP_000368338.1.80687 WP_000368338.1.80717 WP_000368338.1.80734 WP_000368338.1.80761 WP_000368338.1.80762 WP_000368338.1.80763 WP_000368338.1.8077 WP_000368338.1.80781 WP_000368338.1.80786 WP_000368338.1.80793 WP_000368338.1.80801 WP_000368338.1.80828 WP_000368338.1.80833 WP_000368338.1.8084 WP_000368338.1.80845 WP_000368338.1.8085 WP_000368338.1.80855 WP_000368338.1.80872 WP_000368338.1.809 WP_000368338.1.80962 WP_000368338.1.80972 WP_000368338.1.80979 WP_000368338.1.80980 WP_000368338.1.81010 WP_000368338.1.81065 WP_000368338.1.81085 WP_000368338.1.81092 WP_000368338.1.81097 WP_000368338.1.81114 WP_000368338.1.81157 WP_000368338.1.81171 WP_000368338.1.81224 WP_000368338.1.81234 WP_000368338.1.81243 WP_000368338.1.8125 WP_000368338.1.81252 WP_000368338.1.81344 WP_000368338.1.8135 WP_000368338.1.81384 WP_000368338.1.81385 WP_000368338.1.81387 WP_000368338.1.81389 WP_000368338.1.8142 WP_000368338.1.81436 WP_000368338.1.8144 WP_000368338.1.81464 WP_000368338.1.81467 WP_000368338.1.81522 WP_000368338.1.81532 WP_000368338.1.81549 WP_000368338.1.81572 WP_000368338.1.81599 WP_000368338.1.81610 WP_000368338.1.81631 WP_000368338.1.81637 WP_000368338.1.81651 WP_000368338.1.81718 WP_000368338.1.81734 WP_000368338.1.81738 WP_000368338.1.81740 WP_000368338.1.81758 WP_000368338.1.8176 WP_000368338.1.81767 WP_000368338.1.81789 WP_000368338.1.81800 WP_000368338.1.81810 WP_000368338.1.81812 WP_000368338.1.81829 WP_000368338.1.81831 WP_000368338.1.81847 WP_000368338.1.81861 WP_000368338.1.81870 WP_000368338.1.8188 WP_000368338.1.81897 WP_000368338.1.81903 WP_000368338.1.81904 WP_000368338.1.81905 WP_000368338.1.81906 WP_000368338.1.81919 WP_000368338.1.81940 WP_000368338.1.81944 WP_000368338.1.81955 WP_000368338.1.81982 WP_000368338.1.81996 WP_000368338.1.81999 WP_000368338.1.82009 WP_000368338.1.82015 WP_000368338.1.82017 WP_000368338.1.82026 WP_000368338.1.82053 WP_000368338.1.82058 WP_000368338.1.82091 WP_000368338.1.82100 WP_000368338.1.82121 WP_000368338.1.82161 WP_000368338.1.82167 WP_000368338.1.82219 WP_000368338.1.82234 WP_000368338.1.82247 WP_000368338.1.82259 WP_000368338.1.82315 WP_000368338.1.82321 WP_000368338.1.82340 WP_000368338.1.82354 WP_000368338.1.82358 WP_000368338.1.82368 WP_000368338.1.8244 WP_000368338.1.82441 WP_000368338.1.82447 WP_000368338.1.82455 WP_000368338.1.8246 WP_000368338.1.82467 WP_000368338.1.82472 WP_000368338.1.8261 WP_000368338.1.82612 WP_000368338.1.8265 WP_000368338.1.82664 WP_000368338.1.82665 WP_000368338.1.82709 WP_000368338.1.82724 WP_000368338.1.82760 WP_000368338.1.82762 WP_000368338.1.82775 WP_000368338.1.82796 WP_000368338.1.8280 WP_000368338.1.82802 WP_000368338.1.82829 WP_000368338.1.82835 WP_000368338.1.82862 WP_000368338.1.8288 WP_000368338.1.8289 WP_000368338.1.82916 WP_000368338.1.82931 WP_000368338.1.82976 WP_000368338.1.82984 WP_000368338.1.82997 WP_000368338.1.82999 WP_000368338.1.83011 WP_000368338.1.83013 WP_000368338.1.8302 WP_000368338.1.83021 WP_000368338.1.83050 WP_000368338.1.83053 WP_000368338.1.83066 WP_000368338.1.83088 WP_000368338.1.8310 WP_000368338.1.83152 WP_000368338.1.83153 WP_000368338.1.83185 WP_000368338.1.8319 WP_000368338.1.83193 WP_000368338.1.83234 WP_000368338.1.83243 WP_000368338.1.83249 WP_000368338.1.83250 WP_000368338.1.8328 WP_000368338.1.83314 WP_000368338.1.83316 WP_000368338.1.83352 WP_000368338.1.83372 WP_000368338.1.83416 WP_000368338.1.83418 WP_000368338.1.83475 WP_000368338.1.83476 WP_000368338.1.83484 WP_000368338.1.83517 WP_000368338.1.83541 WP_000368338.1.83592 WP_000368338.1.83593 WP_000368338.1.83597 WP_000368338.1.83626 WP_000368338.1.83645 WP_000368338.1.83646 WP_000368338.1.83652 WP_000368338.1.83653 WP_000368338.1.83676 WP_000368338.1.83714 WP_000368338.1.83720 WP_000368338.1.83763 WP_000368338.1.83769 WP_000368338.1.83778 WP_000368338.1.83792 WP_000368338.1.83804 WP_000368338.1.83816 WP_000368338.1.83825 WP_000368338.1.8383 WP_000368338.1.83837 WP_000368338.1.83852 WP_000368338.1.83864 WP_000368338.1.83865 WP_000368338.1.83881 WP_000368338.1.83902 WP_000368338.1.83912 WP_000368338.1.83925 WP_000368338.1.83935 WP_000368338.1.83955 WP_000368338.1.83980 WP_000368338.1.83984 WP_000368338.1.84010 WP_000368338.1.84041 WP_000368338.1.84049 WP_000368338.1.84067 WP_000368338.1.84068 WP_000368338.1.84144 WP_000368338.1.84163 WP_000368338.1.84194 WP_000368338.1.84284 WP_000368338.1.84293 WP_000368338.1.8432 WP_000368338.1.84322 WP_000368338.1.84342 WP_000368338.1.84414 WP_000368338.1.84416 WP_000368338.1.84442 WP_000368338.1.84445 WP_000368338.1.84451 WP_000368338.1.84509 WP_000368338.1.84555 WP_000368338.1.84563 WP_000368338.1.84570 WP_000368338.1.84578 WP_000368338.1.84602 WP_000368338.1.84612 WP_000368338.1.84625 WP_000368338.1.84630 WP_000368338.1.84638 WP_000368338.1.84652 WP_000368338.1.84662 WP_000368338.1.84673 WP_000368338.1.84679 WP_000368338.1.8468 WP_000368338.1.84682 WP_000368338.1.84700 WP_000368338.1.84714 WP_000368338.1.84736 WP_000368338.1.8475 WP_000368338.1.84752 WP_000368338.1.84757 WP_000368338.1.84761 WP_000368338.1.84770 WP_000368338.1.84815 WP_000368338.1.84844 WP_000368338.1.84874 WP_000368338.1.84889 WP_000368338.1.84903 WP_000368338.1.84907 WP_000368338.1.84922 WP_000368338.1.8493 WP_000368338.1.84951 WP_000368338.1.85022 WP_000368338.1.85047 WP_000368338.1.85056 WP_000368338.1.85081 WP_000368338.1.85083 WP_000368338.1.85099 WP_000368338.1.851 WP_000368338.1.85113 WP_000368338.1.85132 WP_000368338.1.85133 WP_000368338.1.85135 WP_000368338.1.85144 WP_000368338.1.85151 WP_000368338.1.85160 WP_000368338.1.85173 WP_000368338.1.85198 WP_000368338.1.85213 WP_000368338.1.85224 WP_000368338.1.85226 WP_000368338.1.85231 WP_000368338.1.85235 WP_000368338.1.85238 WP_000368338.1.85265 WP_000368338.1.85292 WP_000368338.1.85294 WP_000368338.1.85297 WP_000368338.1.85331 WP_000368338.1.85351 WP_000368338.1.85354 WP_000368338.1.85374 WP_000368338.1.85383 WP_000368338.1.85391 WP_000368338.1.85395 WP_000368338.1.85401 WP_000368338.1.85404 WP_000368338.1.85425 WP_000368338.1.85440 WP_000368338.1.85445 WP_000368338.1.85455 WP_000368338.1.85462 WP_000368338.1.85471 WP_000368338.1.85474 WP_000368338.1.85492 WP_000368338.1.85506 WP_000368338.1.85515 WP_000368338.1.85519 WP_000368338.1.85542 WP_000368338.1.85547 WP_000368338.1.85549 WP_000368338.1.85555 WP_000368338.1.85562 WP_000368338.1.85586 WP_000368338.1.85607 WP_000368338.1.85634 WP_000368338.1.85649 WP_000368338.1.85678 WP_000368338.1.85705 WP_000368338.1.8572 WP_000368338.1.85758 WP_000368338.1.8576 WP_000368338.1.85795 WP_000368338.1.85796 WP_000368338.1.85809 WP_000368338.1.85816 WP_000368338.1.85825 WP_000368338.1.85834 WP_000368338.1.85844 WP_000368338.1.85873 WP_000368338.1.85927 WP_000368338.1.85950 WP_000368338.1.85993 WP_000368338.1.86072 WP_000368338.1.8609 WP_000368338.1.86101 WP_000368338.1.86106 WP_000368338.1.86123 WP_000368338.1.86136 WP_000368338.1.86144 WP_000368338.1.86153 WP_000368338.1.86154 WP_000368338.1.86158 WP_000368338.1.86178 WP_000368338.1.86188 WP_000368338.1.86197 WP_000368338.1.86207 WP_000368338.1.86241 WP_000368338.1.86248 WP_000368338.1.86256 WP_000368338.1.8627 WP_000368338.1.86270 WP_000368338.1.86304 WP_000368338.1.86331 WP_000368338.1.86344 WP_000368338.1.86367 WP_000368338.1.86378 WP_000368338.1.8641 WP_000368338.1.8643 WP_000368338.1.86455 WP_000368338.1.86482 WP_000368338.1.86505 WP_000368338.1.86508 WP_000368338.1.86523 WP_000368338.1.86526 WP_000368338.1.86542 WP_000368338.1.86606 WP_000368338.1.86628 WP_000368338.1.86629 WP_000368338.1.8663 WP_000368338.1.86706 WP_000368338.1.86754 WP_000368338.1.86792 WP_000368338.1.8681 WP_000368338.1.86838 WP_000368338.1.86911 WP_000368338.1.86916 WP_000368338.1.86940 WP_000368338.1.86955 WP_000368338.1.86961 WP_000368338.1.86977 WP_000368338.1.8699 WP_000368338.1.87021 WP_000368338.1.87022 WP_000368338.1.87042 WP_000368338.1.87057 WP_000368338.1.87072 WP_000368338.1.87090 WP_000368338.1.87096 WP_000368338.1.87110 WP_000368338.1.87119 WP_000368338.1.87122 WP_000368338.1.87141 WP_000368338.1.87175 WP_000368338.1.87194 WP_000368338.1.8720 WP_000368338.1.87236 WP_000368338.1.87250 WP_000368338.1.87260 WP_000368338.1.87261 WP_000368338.1.87263 WP_000368338.1.87264 WP_000368338.1.87272 WP_000368338.1.87285 WP_000368338.1.87290 WP_000368338.1.8731 WP_000368338.1.87378 WP_000368338.1.87391 WP_000368338.1.87396 WP_000368338.1.87397 WP_000368338.1.87425 WP_000368338.1.87434 WP_000368338.1.87457 WP_000368338.1.87461 WP_000368338.1.87466 WP_000368338.1.87475 WP_000368338.1.87497 WP_000368338.1.87498 WP_000368338.1.875 WP_000368338.1.87502 WP_000368338.1.87508 WP_000368338.1.87515 WP_000368338.1.8753 WP_000368338.1.87534 WP_000368338.1.87543 WP_000368338.1.8757 WP_000368338.1.87579 WP_000368338.1.87593 WP_000368338.1.87601 WP_000368338.1.87623 WP_000368338.1.87636 WP_000368338.1.87647 WP_000368338.1.87682 WP_000368338.1.8770 WP_000368338.1.87703 WP_000368338.1.87710 WP_000368338.1.87718 WP_000368338.1.87735 WP_000368338.1.87740 WP_000368338.1.87748 WP_000368338.1.87764 WP_000368338.1.8779 WP_000368338.1.87802 WP_000368338.1.87808 WP_000368338.1.87828 WP_000368338.1.87843 WP_000368338.1.87879 WP_000368338.1.87912 WP_000368338.1.87943 WP_000368338.1.87948 WP_000368338.1.87963 WP_000368338.1.87972 WP_000368338.1.87985 WP_000368338.1.87995 WP_000368338.1.88013 WP_000368338.1.88061 WP_000368338.1.88101 WP_000368338.1.88114 WP_000368338.1.88150 WP_000368338.1.88166 WP_000368338.1.8820 WP_000368338.1.88212 WP_000368338.1.88240 WP_000368338.1.88270 WP_000368338.1.88279 WP_000368338.1.88311 WP_000368338.1.88317 WP_000368338.1.88319 WP_000368338.1.88328 WP_000368338.1.88339 WP_000368338.1.88348 WP_000368338.1.88351 WP_000368338.1.88367 WP_000368338.1.88371 WP_000368338.1.88380 WP_000368338.1.88395 WP_000368338.1.88445 WP_000368338.1.88455 WP_000368338.1.88471 WP_000368338.1.88473 WP_000368338.1.88478 WP_000368338.1.88480 WP_000368338.1.88490 WP_000368338.1.88498 WP_000368338.1.88504 WP_000368338.1.88518 WP_000368338.1.88536 WP_000368338.1.88558 WP_000368338.1.8857 WP_000368338.1.88572 WP_000368338.1.88580 WP_000368338.1.88583 WP_000368338.1.88599 WP_000368338.1.88623 WP_000368338.1.88636 WP_000368338.1.88638 WP_000368338.1.88642 WP_000368338.1.88671 WP_000368338.1.88694 WP_000368338.1.8872 WP_000368338.1.88738 WP_000368338.1.88739 WP_000368338.1.88753 WP_000368338.1.88761 WP_000368338.1.8877 WP_000368338.1.88805 WP_000368338.1.88827 WP_000368338.1.88856 WP_000368338.1.88859 WP_000368338.1.88861 WP_000368338.1.88871 WP_000368338.1.88874 WP_000368338.1.8888 WP_000368338.1.88881 WP_000368338.1.88912 WP_000368338.1.88922 WP_000368338.1.88934 WP_000368338.1.88959 WP_000368338.1.8900 WP_000368338.1.89027 WP_000368338.1.8904 WP_000368338.1.89086 WP_000368338.1.89103 WP_000368338.1.89108 WP_000368338.1.8913 WP_000368338.1.89133 WP_000368338.1.89139 WP_000368338.1.89173 WP_000368338.1.89181 WP_000368338.1.89194 WP_000368338.1.89195 WP_000368338.1.89204 WP_000368338.1.89216 WP_000368338.1.89229 WP_000368338.1.89235 WP_000368338.1.89237 WP_000368338.1.8924 WP_000368338.1.89258 WP_000368338.1.89284 WP_000368338.1.8929 WP_000368338.1.89347 WP_000368338.1.89372 WP_000368338.1.89414 WP_000368338.1.89439 WP_000368338.1.89476 WP_000368338.1.8950 WP_000368338.1.89516 WP_000368338.1.8953 WP_000368338.1.89537 WP_000368338.1.89545 WP_000368338.1.89556 WP_000368338.1.89557 WP_000368338.1.89559 WP_000368338.1.89594 WP_000368338.1.89603 WP_000368338.1.89628 WP_000368338.1.89651 WP_000368338.1.89655 WP_000368338.1.89672 WP_000368338.1.89678 WP_000368338.1.89686 WP_000368338.1.89715 WP_000368338.1.89726 WP_000368338.1.89730 WP_000368338.1.89754 WP_000368338.1.89799 WP_000368338.1.89857 WP_000368338.1.8986 WP_000368338.1.89860 WP_000368338.1.89874 WP_000368338.1.89883 WP_000368338.1.8990 WP_000368338.1.89924 WP_000368338.1.89933 WP_000368338.1.89935 WP_000368338.1.89960 WP_000368338.1.90005 WP_000368338.1.90018 WP_000368338.1.90038 WP_000368338.1.90046 WP_000368338.1.90055 WP_000368338.1.90091 WP_000368338.1.90095 WP_000368338.1.90112 WP_000368338.1.90145 WP_000368338.1.90148 WP_000368338.1.90161 WP_000368338.1.90180 WP_000368338.1.90215 WP_000368338.1.9022 WP_000368338.1.90232 WP_000368338.1.90239 WP_000368338.1.90243 WP_000368338.1.90244 WP_000368338.1.90253 WP_000368338.1.90269 WP_000368338.1.90276 WP_000368338.1.9030 WP_000368338.1.90307 WP_000368338.1.90331 WP_000368338.1.90345 WP_000368338.1.90367 WP_000368338.1.90370 WP_000368338.1.90432 WP_000368338.1.90473 WP_000368338.1.90514 WP_000368338.1.90544 WP_000368338.1.90548 WP_000368338.1.9055 WP_000368338.1.90554 WP_000368338.1.90562 WP_000368338.1.90604 WP_000368338.1.90647 WP_000368338.1.90660 WP_000368338.1.90683 WP_000368338.1.9071 WP_000368338.1.90717 WP_000368338.1.90726 WP_000368338.1.90728 WP_000368338.1.90738 WP_000368338.1.9074 WP_000368338.1.90740 WP_000368338.1.90745 WP_000368338.1.90757 WP_000368338.1.90777 WP_000368338.1.90801 WP_000368338.1.90804 WP_000368338.1.90818 WP_000368338.1.90820 WP_000368338.1.90861 WP_000368338.1.90875 WP_000368338.1.90887 WP_000368338.1.90896 WP_000368338.1.90903 WP_000368338.1.90923 WP_000368338.1.90928 WP_000368338.1.90994 WP_000368338.1.9100 WP_000368338.1.91011 WP_000368338.1.91054 WP_000368338.1.91087 WP_000368338.1.91089 WP_000368338.1.91126 WP_000368338.1.9114 WP_000368338.1.91158 WP_000368338.1.91177 WP_000368338.1.91184 WP_000368338.1.912 WP_000368338.1.91233 WP_000368338.1.91246 WP_000368338.1.91252 WP_000368338.1.91258 WP_000368338.1.9127 WP_000368338.1.91279 WP_000368338.1.91297 WP_000368338.1.9130 WP_000368338.1.91300 WP_000368338.1.91310 WP_000368338.1.91316 WP_000368338.1.91332 WP_000368338.1.91346 WP_000368338.1.91364 WP_000368338.1.91365 WP_000368338.1.91380 WP_000368338.1.91382 WP_000368338.1.9140 WP_000368338.1.91420 WP_000368338.1.91427 WP_000368338.1.91465 WP_000368338.1.91487 WP_000368338.1.91500 WP_000368338.1.91501 WP_000368338.1.9153 WP_000368338.1.91542 WP_000368338.1.91547 WP_000368338.1.91559 WP_000368338.1.91573 WP_000368338.1.91581 WP_000368338.1.91587 WP_000368338.1.91591 WP_000368338.1.91624 WP_000368338.1.91629 WP_000368338.1.91635 WP_000368338.1.91639 WP_000368338.1.91660 WP_000368338.1.91746 WP_000368338.1.91749 WP_000368338.1.91771 WP_000368338.1.91781 WP_000368338.1.91791 WP_000368338.1.91816 WP_000368338.1.91829 WP_000368338.1.91895 WP_000368338.1.91909 WP_000368338.1.91911 WP_000368338.1.91928 WP_000368338.1.91950 WP_000368338.1.91955 WP_000368338.1.92 WP_000368338.1.92055 WP_000368338.1.92057 WP_000368338.1.92104 WP_000368338.1.92110 WP_000368338.1.92115 WP_000368338.1.92133 WP_000368338.1.92140 WP_000368338.1.92147 WP_000368338.1.92164 WP_000368338.1.92169 WP_000368338.1.92173 WP_000368338.1.92185 WP_000368338.1.92196 WP_000368338.1.92218 WP_000368338.1.92227 WP_000368338.1.9224 WP_000368338.1.92253 WP_000368338.1.92259 WP_000368338.1.92278 WP_000368338.1.92297 WP_000368338.1.92324 WP_000368338.1.9234 WP_000368338.1.92340 WP_000368338.1.9237 WP_000368338.1.9239 WP_000368338.1.92398 WP_000368338.1.92415 WP_000368338.1.92424 WP_000368338.1.92436 WP_000368338.1.92442 WP_000368338.1.92497 WP_000368338.1.92500 WP_000368338.1.92520 WP_000368338.1.92534 WP_000368338.1.92541 WP_000368338.1.92544 WP_000368338.1.92546 WP_000368338.1.92560 WP_000368338.1.92565 WP_000368338.1.92602 WP_000368338.1.92607 WP_000368338.1.92679 WP_000368338.1.92688 WP_000368338.1.92691 WP_000368338.1.92723 WP_000368338.1.92726 WP_000368338.1.92735 WP_000368338.1.92741 WP_000368338.1.92772 WP_000368338.1.92773 WP_000368338.1.92778 WP_000368338.1.92789 WP_000368338.1.92805 WP_000368338.1.92840 WP_000368338.1.92849 WP_000368338.1.92862 WP_000368338.1.92864 WP_000368338.1.92897 WP_000368338.1.92918 WP_000368338.1.9293 WP_000368338.1.92937 WP_000368338.1.92950 WP_000368338.1.92960 WP_000368338.1.9298 WP_000368338.1.93010 WP_000368338.1.93041 WP_000368338.1.93068 WP_000368338.1.93074 WP_000368338.1.93078 WP_000368338.1.93125 WP_000368338.1.93141 WP_000368338.1.93163 WP_000368338.1.93176 WP_000368338.1.93186 WP_000368338.1.93191 WP_000368338.1.93198 WP_000368338.1.93207 WP_000368338.1.93224 WP_000368338.1.93231 WP_000368338.1.93235 WP_000368338.1.93251 WP_000368338.1.93263 WP_000368338.1.93272 WP_000368338.1.9330 WP_000368338.1.93300 WP_000368338.1.93310 WP_000368338.1.93316 WP_000368338.1.93329 WP_000368338.1.93336 WP_000368338.1.93354 WP_000368338.1.93374 WP_000368338.1.93416 WP_000368338.1.93435 WP_000368338.1.93438 WP_000368338.1.93444 WP_000368338.1.9346 WP_000368338.1.93492 WP_000368338.1.93514 WP_000368338.1.9352 WP_000368338.1.93538 WP_000368338.1.9354 WP_000368338.1.93561 WP_000368338.1.9358 WP_000368338.1.93590 WP_000368338.1.93613 WP_000368338.1.93647 WP_000368338.1.93658 WP_000368338.1.93669 WP_000368338.1.93678 WP_000368338.1.93690 WP_000368338.1.93710 WP_000368338.1.93722 WP_000368338.1.93738 WP_000368338.1.93769 WP_000368338.1.93787 WP_000368338.1.93862 WP_000368338.1.9387 WP_000368338.1.93882 WP_000368338.1.93883 WP_000368338.1.93891 WP_000368338.1.9392 WP_000368338.1.93934 WP_000368338.1.93972 WP_000368338.1.93975 WP_000368338.1.93976 WP_000368338.1.9398 WP_000368338.1.93981 WP_000368338.1.94009 WP_000368338.1.94016 WP_000368338.1.94060 WP_000368338.1.94074 WP_000368338.1.94082 WP_000368338.1.94087 WP_000368338.1.94093 WP_000368338.1.94096 WP_000368338.1.94114 WP_000368338.1.94119 WP_000368338.1.94165 WP_000368338.1.94172 WP_000368338.1.94182 WP_000368338.1.94209 WP_000368338.1.94229 WP_000368338.1.94293 WP_000368338.1.94294 WP_000368338.1.94319 WP_000368338.1.94325 WP_000368338.1.94335 WP_000368338.1.94340 WP_000368338.1.94345 WP_000368338.1.9435 WP_000368338.1.9437 WP_000368338.1.94374 WP_000368338.1.94375 WP_000368338.1.94376 WP_000368338.1.94389 WP_000368338.1.94407 WP_000368338.1.94409 WP_000368338.1.94414 WP_000368338.1.94423 WP_000368338.1.94530 WP_000368338.1.94549 WP_000368338.1.94550 WP_000368338.1.94576 WP_000368338.1.94625 WP_000368338.1.94636 WP_000368338.1.94641 WP_000368338.1.94688 WP_000368338.1.94719 WP_000368338.1.94733 WP_000368338.1.94741 WP_000368338.1.94789 WP_000368338.1.94797 WP_000368338.1.94838 WP_000368338.1.94844 WP_000368338.1.94845 WP_000368338.1.9485 WP_000368338.1.94857 WP_000368338.1.94866 WP_000368338.1.94941 WP_000368338.1.9495 WP_000368338.1.94958 WP_000368338.1.9497 WP_000368338.1.94980 WP_000368338.1.94989 WP_000368338.1.94999 WP_000368338.1.95002 WP_000368338.1.95014 WP_000368338.1.95038 WP_000368338.1.95049 WP_000368338.1.95077 WP_000368338.1.95090 WP_000368338.1.9510 WP_000368338.1.95120 WP_000368338.1.95154 WP_000368338.1.95174 WP_000368338.1.95304 WP_000368338.1.95307 WP_000368338.1.95327 WP_000368338.1.95342 WP_000368338.1.95361 WP_000368338.1.95372 WP_000368338.1.9538 WP_000368338.1.95409 WP_000368338.1.95442 WP_000368338.1.95452 WP_000368338.1.95476 WP_000368338.1.95495 WP_000368338.1.95500 WP_000368338.1.95505 WP_000368338.1.95535 WP_000368338.1.95537 WP_000368338.1.95545 WP_000368338.1.95552 WP_000368338.1.9557 WP_000368338.1.95571 WP_000368338.1.95581 WP_000368338.1.95603 WP_000368338.1.95631 WP_000368338.1.95639 WP_000368338.1.95640 WP_000368338.1.95681 WP_000368338.1.95699 WP_000368338.1.95704 WP_000368338.1.95713 WP_000368338.1.95714 WP_000368338.1.95737 WP_000368338.1.95760 WP_000368338.1.95781 WP_000368338.1.95806 WP_000368338.1.95877 WP_000368338.1.95885 WP_000368338.1.95914 WP_000368338.1.95918 WP_000368338.1.95947 WP_000368338.1.95954 WP_000368338.1.95983 WP_000368338.1.95986 WP_000368338.1.95997 WP_000368338.1.96014 WP_000368338.1.96022 WP_000368338.1.96030 WP_000368338.1.96056 WP_000368338.1.96057 WP_000368338.1.96067 WP_000368338.1.96075 WP_000368338.1.96105 WP_000368338.1.96133 WP_000368338.1.96135 WP_000368338.1.96148 WP_000368338.1.96165 WP_000368338.1.96200 WP_000368338.1.96221 WP_000368338.1.96228 WP_000368338.1.96255 WP_000368338.1.96261 WP_000368338.1.96280 WP_000368338.1.96283 WP_000368338.1.96297 WP_000368338.1.96301 WP_000368338.1.96312 WP_000368338.1.96314 WP_000368338.1.96322 WP_000368338.1.96334 WP_000368338.1.96362 WP_000368338.1.96364 WP_000368338.1.96368 WP_000368338.1.96412 WP_000368338.1.96424 WP_000368338.1.96433 WP_000368338.1.96472 WP_000368338.1.96474 WP_000368338.1.96477 WP_000368338.1.96489 WP_000368338.1.96495 WP_000368338.1.9650 WP_000368338.1.96509 WP_000368338.1.96535 WP_000368338.1.96538 WP_000368338.1.96548 WP_000368338.1.96550 WP_000368338.1.96554 WP_000368338.1.96566 WP_000368338.1.96577 WP_000368338.1.96578 WP_000368338.1.96591 WP_000368338.1.96603 WP_000368338.1.96613 WP_000368338.1.96628 WP_000368338.1.96637 WP_000368338.1.96638 WP_000368338.1.96663 WP_000368338.1.96678 WP_000368338.1.96682 WP_000368338.1.96699 WP_000368338.1.96705 WP_000368338.1.96718 WP_000368338.1.9675 WP_000368338.1.96780 WP_000368338.1.96836 WP_000368338.1.9684 WP_000368338.1.96854 WP_000368338.1.96855 WP_000368338.1.96856 WP_000368338.1.96859 WP_000368338.1.96892 WP_000368338.1.96922 WP_000368338.1.96928 WP_000368338.1.96956 WP_000368338.1.96965 WP_000368338.1.96969 WP_000368338.1.96970 WP_000368338.1.96985 WP_000368338.1.97000 WP_000368338.1.97004 WP_000368338.1.97014 WP_000368338.1.97029 WP_000368338.1.97033 WP_000368338.1.97034 WP_000368338.1.97077 WP_000368338.1.97141 WP_000368338.1.97146 WP_000368338.1.97151 WP_000368338.1.97161 WP_000368338.1.97164 WP_000368338.1.97205 WP_000368338.1.97206 WP_000368338.1.97228 WP_000368338.1.97230 WP_000368338.1.97241 WP_000368338.1.97256 WP_000368338.1.97276 WP_000368338.1.97293 WP_000368338.1.97302 WP_000368338.1.97311 WP_000368338.1.97312 WP_000368338.1.97336 WP_000368338.1.97348 WP_000368338.1.97352 WP_000368338.1.97355 WP_000368338.1.97367 WP_000368338.1.9737 WP_000368338.1.97392 WP_000368338.1.97399 WP_000368338.1.97409 WP_000368338.1.97427 WP_000368338.1.97444 WP_000368338.1.97450 WP_000368338.1.97456 WP_000368338.1.97460 WP_000368338.1.9748 WP_000368338.1.97484 WP_000368338.1.97494 WP_000368338.1.97530 WP_000368338.1.97531 WP_000368338.1.97537 WP_000368338.1.97575 WP_000368338.1.97576 WP_000368338.1.9758 WP_000368338.1.97585 WP_000368338.1.97590 WP_000368338.1.97641 WP_000368338.1.97664 WP_000368338.1.97687 WP_000368338.1.97688 WP_000368338.1.97696 WP_000368338.1.97699 WP_000368338.1.97706 WP_000368338.1.97717 WP_000368338.1.97720 WP_000368338.1.97742 WP_000368338.1.97744 WP_000368338.1.97746 WP_000368338.1.97762 WP_000368338.1.97763 WP_000368338.1.97776 WP_000368338.1.9788 WP_000368338.1.97898 WP_000368338.1.97935 WP_000368338.1.97953 WP_000368338.1.97955 WP_000368338.1.97974 WP_000368338.1.97997 WP_000368338.1.98008 WP_000368338.1.98054 WP_000368338.1.98058 WP_000368338.1.98073 WP_000368338.1.98077 WP_000368338.1.98131 WP_000368338.1.98161 WP_000368338.1.98174 WP_000368338.1.98179 WP_000368338.1.98195 WP_000368338.1.98233 WP_000368338.1.98248 WP_000368338.1.98249 WP_000368338.1.98281 WP_000368338.1.98295 WP_000368338.1.98322 WP_000368338.1.98352 WP_000368338.1.98353 WP_000368338.1.98359 WP_000368338.1.98366 WP_000368338.1.98372 WP_000368338.1.98387 WP_000368338.1.98394 WP_000368338.1.98409 WP_000368338.1.98419 WP_000368338.1.98425 WP_000368338.1.98497 WP_000368338.1.98501 WP_000368338.1.98506 WP_000368338.1.98510 WP_000368338.1.98533 WP_000368338.1.98548 WP_000368338.1.98559 WP_000368338.1.98585 WP_000368338.1.98586 WP_000368338.1.98609 WP_000368338.1.98659 WP_000368338.1.98667 WP_000368338.1.98703 WP_000368338.1.98710 WP_000368338.1.9872 WP_000368338.1.98723 WP_000368338.1.98730 WP_000368338.1.98734 WP_000368338.1.98741 WP_000368338.1.98750 WP_000368338.1.98786 WP_000368338.1.98797 WP_000368338.1.98805 WP_000368338.1.98807 WP_000368338.1.98821 WP_000368338.1.98825 WP_000368338.1.98842 WP_000368338.1.98865 WP_000368338.1.98880 WP_000368338.1.98883 WP_000368338.1.98894 WP_000368338.1.98912 WP_000368338.1.98924 WP_000368338.1.98978 WP_000368338.1.98981 WP_000368338.1.98985 WP_000368338.1.99027 WP_000368338.1.99081 WP_000368338.1.99090 WP_000368338.1.991 WP_000368338.1.9910 WP_000368338.1.99136 WP_000368338.1.99174 WP_000368338.1.99183 WP_000368338.1.99195 WP_000368338.1.99207 WP_000368338.1.99228 WP_000368338.1.99262 WP_000368338.1.99283 WP_000368338.1.99308 WP_000368338.1.99311 WP_000368338.1.99331 WP_000368338.1.99394 WP_000368338.1.99414 WP_000368338.1.99418 WP_000368338.1.99509 WP_000368338.1.99523 WP_000368338.1.99524 WP_000368338.1.99525 WP_000368338.1.9965 WP_000368338.1.99683 WP_000368338.1.99688 WP_000368338.1.99700 WP_000368338.1.99714 WP_000368338.1.9974 WP_000368338.1.99768 WP_000368338.1.99777 WP_000368338.1.99830 WP_000368338.1.99849 WP_000368338.1.9985 WP_000368338.1.99859 WP_000368338.1.99862 WP_000368338.1.99884 WP_000368338.1.99901 WP_000368338.1.99934 WP_000368338.1.99950 WP_000368338.1.99954 WP_000368338.1.99955 WP_000368338.1.99963 WP_000368338.1.99984 WP_000368338.1.99999 gi|379021366|ref|YP_005298028.1| gi|384550412|ref|YP_005739664.1| gi|537442891|ref|YP_008485468.1| gi|384867442|ref|YP_005747638.1| gi|545635063|ref|YP_008585633.1| gi|148268068|ref|YP_001247011.1| gi|156979903|ref|YP_001442162.1| gi|470222898|ref|YP_007621455.1| gi|470197340|ref|YP_007583741.1| 158878.SAV1585 158879.SA1413 273036.SAB1457c 282458.SAR1662 282459.SAS1522 359786.SaurJH9_1642 359787.SaurJH1_1677 418127.SAHV_1572 681288.SAAV_1576 gi|386831194|ref|YP_006237848.1| gi|470224865|ref|YP_007623444.1| gi|387150728|ref|YP_005742292.1| gi|384547817|ref|YP_005737070.1| gi|470219077|ref|YP_007619471.1| gi|545637922|ref|YP_008588098.1| gi|387780676|ref|YP_005755474.1| gi|470195375|ref|YP_007581727.1| gi|384864805|ref|YP_005750164.1| gi|514066518|ref|YP_008128438.1| gi|269203212|ref|YP_003282481.1| gi|470193409|ref|YP_007579762.1| gi|49483832|ref|YP_041056.1| gi|532359676|ref|YP_008449505.1| gi|15924575|ref|NP_372109.1| gi|470191444|ref|YP_007577754.1| gi|82751188|ref|YP_416929.1| gi|386729286|ref|YP_006195669.1| gi|470199308|ref|YP_007585708.1| gi|150394137|ref|YP_001316812.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]