SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|55822278|ref|YP_140719.1| from Streptococcus thermophilus CNRZ1066

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|55822278|ref|YP_140719.1|
Domain Number 1 Region: 36-290
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.4e-71
Family Phosphate binding protein-like 0.00000526
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|55822278|ref|YP_140719.1|
Sequence length 300
Comment ABC transporter substrate binding protein [Streptococcus thermophilus CNRZ1066]
Sequence
MKFKKILGITVLAVASTVALAACGAGGNKSAKDDKTLTVGIMTLDNTTEPVWDKVKELAK
DKGVTIDLKEFTDFNQPNKALKNGEIDVNAFQHIYFLNNWNKENKGDLVPVADTLLSPIH
LFSGTENGKAKYKDVKELPEGATISVPNDSTNESRALTLLQTAGLLKLDVKDGELATIKN
ISENPKKLEIKEISAEQAAQTLSSVDAAVVNNTYAQQQNVDYNTTLFQEDPSQDLKEWVN
IIAANKDWEKSNKSDAIKTLIKAYQNDEVAQIIYDASNKVDLPAWKGAPTRDQLEANSKK
Download sequence
Identical sequences A0A0E2RG43 A0A0M4HYP7 F8LV54 Q5M5Z3 V8LZZ4
gi|116627221|ref|YP_819840.1| gi|55822278|ref|YP_140719.1| gi|387909091|ref|YP_006339397.1| WP_002949597.1.14318 WP_002949597.1.14497 WP_002949597.1.20409 WP_002949597.1.22909 WP_002949597.1.25847 WP_002949597.1.35143 WP_002949597.1.40951 WP_002949597.1.45745 WP_002949597.1.46579 WP_002949597.1.52035 WP_002949597.1.53867 WP_002949597.1.54201 WP_002949597.1.56630 WP_002949597.1.61786 WP_002949597.1.622 WP_002949597.1.70431 WP_002949597.1.75065 WP_002949597.1.77140 WP_002949597.1.77415 WP_002949597.1.83814 WP_002949597.1.86693 WP_002949597.1.90490 WP_002949597.1.91396 WP_002949597.1.92232 WP_002949597.1.92807 WP_002949597.1.94133 WP_002949597.1.96332 264199.stu0297 299768.str0297 322159.STER_0340 gi|55820392|ref|YP_138834.1| gi|386343932|ref|YP_006040096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]