SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56752098|ref|YP_172799.1| from Synechococcus elongatus PCC 6301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56752098|ref|YP_172799.1|
Domain Number 1 Region: 97-201
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000589
Family Apolipoprotein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56752098|ref|YP_172799.1|
Sequence length 228
Comment hypothetical protein syc2089_d [Synechococcus elongatus PCC 6301]
Sequence
MTQAQSLDVLNLLEQLEESVLDGTRVPLSGRILVRENDLLDLLDDVRAGLPAAIQQAQQI
LERQAQILADAQQQAQAIVAQAQQERALLIDQNSIRLQAERDAQQLRQTLQQECDALRQQ
AIAEATQVRGEAQQFQLQVRQETDSLRQQTQAEIEQLRSQTQQQLSEQRQRILVECEELR
RGADSYADQVLRDMEQRLTQMMQIIRNGRQALNLSENTPPPAPRRRSR
Download sequence
Identical sequences A0A0H3KBP3 Q31LN3
gi|56752098|ref|YP_172799.1| gi|81300815|ref|YP_401023.1| WP_011244399.1.45845 WP_011244399.1.5740 WP_011244399.1.95485 1140.Synpcc7942_2006 269084.syc2089_d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]