SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56963727|ref|YP_175458.1| from Bacillus clausii KSM-K16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56963727|ref|YP_175458.1|
Domain Number 1 Region: 122-280
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 3.92e-31
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.075
Further Details:      
 
Domain Number 2 Region: 51-108
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000806
Family AraC type transcriptional activator 0.015
Further Details:      
 
Domain Number 3 Region: 4-49
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000193
Family AraC type transcriptional activator 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56963727|ref|YP_175458.1|
Sequence length 280
Comment AraC family transcriptional regulator [Bacillus clausii KSM-K16]
Sequence
MLDSIEYIENHLDNELLLDEIAAVACMSRFHFQRMFRMLTGYAVSEYIRNRRITVAAQEL
VHSKSKVIDVAMKYGYESPESFTKAFRRIHGISPSDAKKHSQSLKAYPKISFQIQLKGDV
EMDYKIVEKDAFTVVGKSIRTTTIGGENNRKIAAFWNESNRNGLSKQLAKNCGPLGLLGI
CIDFDKQQENLTYLIAAEKNSDQIPVDWETRQIPAATWAIFPVHGAMPNAMPKVWERIFS
EWFPATGYEHSGGPEMEVYVSDADPYSKDYYSEIWVPVKK
Download sequence
Identical sequences Q5WGK8
WP_011246805.1.55712 66692.ABC1962 gi|56963727|ref|YP_175458.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]