SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56964844|ref|YP_176575.1| from Bacillus clausii KSM-K16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56964844|ref|YP_176575.1|
Domain Number 1 Region: 8-118
Classification Level Classification E-value
Superfamily FlgN-like 0.00000000000288
Family FlgN-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56964844|ref|YP_176575.1|
Sequence length 144
Comment flagellar protein [Bacillus clausii KSM-K16]
Sequence
MEQSAKKSLENLLHVQKELLASAQKKRQALIQNQVEQLAQLTGTESSLISKSRLLEKALA
EALNGKTLSEMAIQDEECRVLQTQLTEVVQQLKAENEQNQKLLMDSIAFVQGTLQVMQPK
GDATTYTKDAVATGKTKAVFDSKA
Download sequence
Identical sequences Q5WDE6
gi|56964844|ref|YP_176575.1| 66692.ABC3080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]