SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56963879|ref|YP_175610.1| from Bacillus clausii KSM-K16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56963879|ref|YP_175610.1|
Domain Number 1 Region: 149-529
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.89e-74
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.0089
Further Details:      
 
Domain Number 2 Region: 576-796
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.37e-43
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56963879|ref|YP_175610.1|
Sequence length 943
Comment 2-oxoglutarate dehydrogenase E1 [Bacillus clausii KSM-K16]
Sequence
MSSKEHSPEKPWRGFYGPNLGAVIELYDQYVEDPNSVDEQTRAHFEKWGPPALEENVSSS
NAKETIGADMISAVVGAVRLADYIRAKGHLVSDIQPIWKTDKNSNLLDYDRFNVTEEELK
KVPVKLICKDAPPHLKNGLEAIEHLKKVYTQTMAFEFGHVQDEEERNWLRKQVESEAYAD
ELPNKEKKALLERLTSVEGFEKFIHRTFVGQKRFSIEGLDTLVPMLDKAIREVRKEKTDH
VMIGMAHRGRLNVLAHTLGKPYKAIFSEFLQAPNKLNAPSEGLGETYTGWTGDVKYHLGA
DRQISDDKSAQTIVSLANNPSHLEFVSPIVEGYARAAQEDRSSKGAPKQDTTRAYSILIH
GDAAFPGQGVVTETLNLSRLNGYHVGGSLHIIANNNIGYTTEMHDSRSTTYASDPAKGFE
IPIVHVNADDAEACVRAIKFAVEYRRKFQKDFLIDLIGYRRFGHNEGDEPAVTQPDLYAQ
IRKHPTVRAIYAKQLEAEQVITAKEAQKLDTDMYNYLLEEYNKVNSDKSEKKYELSPPDF
IVDGLPKVKTAVEKEKLVAMNEQLLDWPSSFKPNQKLEKILKRRANAFDGEGNVDWGLAE
ILAFASILHDGTPVRLSGQDSERGTFAHRHFVLHDRETNETHVPLQTIKDANASFAVYNS
PLTEQACVGFEYGYNVFSKETLVLWEAQFGDFVNGAQVMFDQWVSAGRAKWGQKSGLVVL
LPHGYEGAGPEHSSGRVERFLSSAAENNWTVANCTSAAQYFHILRRQAKILQKNTVRPLI
IMTPKSLLRNQVVASPTSAFTEGEFQPILEEPTLGHDPNAVKRIILCSGKLAIELQDYVN
KNDEDWSWVHIIRVEELYPFPRRAIRERLKEFPNLEEVKWVQEEPKNMGAWTFMEPRIRE
ILPSGVPLSYIGRTYRSSPAEGVSNAHKVEQKRIVTESLTRKN
Download sequence
Identical sequences A0A268P2V4 Q5WG56
66692.ABC2114 WP_011246957.1.16870 WP_011246957.1.28484 WP_011246957.1.55712 gi|56963879|ref|YP_175610.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]