SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|60115488|ref|YP_209280.1| from Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|60115488|ref|YP_209280.1|
Domain Number 1 Region: 17-138
Classification Level Classification E-value
Superfamily PapD-like 1.47e-37
Family Pilus chaperone 0.00023
Further Details:      
 
Domain Number 2 Region: 144-225
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 2.35e-16
Family Periplasmic chaperone C-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|60115488|ref|YP_209280.1|
Sequence length 227
Comment chaperone protein FanE precursor [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
Sequence
MMKWGLVSLLSLAVSGQAMAAFVLNGTRFIYEEGRKNTSFEVTNQADETFGGQVWIDNTT
QGSSTVYMVPAPPFFKVRPKEKQIIRIMKTDSALPSDRESLFWLNVQEIPPKPKASEGNV
LAVAVNTKVKLIYRPKALVEGRRNAEKNLQITHRGGEAYLKNPTPYYFAVTGVKLNGQPV
RLNDRVMNEIAQLAPKSEVALGKLSLNGTVTVQAVNDWGGTQDYTLK
Download sequence
Identical sequences A0A0K1L9B8 A0A0K1LA11 A0A0K1LA61 H6SI12 Q5J4A6 Q9EUK0 S4HGI9
AY509003|CDS_22142-22825 gi|12084953|ref|NP_073246.1|NC_002638 gi|410503298|ref|YP_006940535.1|NC_019002 gi|60115488|ref|YP_209280.1|NC_006855 321314.SCV26 gi|60115488|ref|YP_209280.1| WP_001541551.1.75400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]