SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62178591|ref|YP_215008.1| from Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62178591|ref|YP_215008.1|
Domain Number 1 Region: 75-193
Classification Level Classification E-value
Superfamily PapD-like 4.97e-39
Family Pilus chaperone 0.0000288
Further Details:      
 
Domain Number 2 Region: 187-269
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 9.94e-17
Family Periplasmic chaperone C-domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|62178591|ref|YP_215008.1|
Sequence length 275
Comment fimbrial chaperone [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
Sequence
MLPRRRHLAWFIPDSLSGFFSRLLGGEKGALRASLRVTNRRHQDITQMKKNVPIFLRLLL
LLSAAGLSFAAQAGGIALGATRVIYPQGSKQTSLPIINSSASNVFLIQSWVANADGSRST
DFIITPPLFVIQPKKENILRIMYVGPSLPTDRESVFYLNSKAIPSVDKNKLTGNSLQIAT
QSVIKLFIRPKNLAEAPAHAPSTLRCRNERGQLTITNPSPYYVSMVELYSAGKKLPNTMV
PPKGAITLPATPGQVSLRTVNDFGATTPARVCPAS
Download sequence
Identical sequences A0A0F6AWE5 B5F700 Q57TN4
gi|62178591|ref|YP_215008.1| 321314.SC0021 454166.SeAg_B0025 ABFH02000001|CDS_268360-267533 AE017220|CDS_24972-25799 CP001138|CDS_24973-25800 CP001363|CDS_24971-25798 gi|563651627|ref|YP_008859680.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]