SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62178595|ref|YP_215012.1| from Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62178595|ref|YP_215012.1|
Domain Number 1 Region: 27-153
Classification Level Classification E-value
Superfamily PapD-like 7.85e-34
Family Pilus chaperone 0.00036
Further Details:      
 
Domain Number 2 Region: 147-233
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 6.41e-20
Family Periplasmic chaperone C-domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62178595|ref|YP_215012.1|
Sequence length 243
Comment fimbrial chaperone [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
Sequence
MPPQPSFLPMNKLFLRCAIYWCLLPISWAQAGVVIGGTRFIYHAGAPALSVPVSNHSEAS
WLIDTHILPGGRWPGTKNEGNIMPFVVTPPLFMLSARQENSMRVVYTGAPLPADRESLFT
LSIAAIPSGKPEANRVQMAFRSALKLLYRPEGLAGNPQQAYRHLIWSLTPDGATVRNPTP
YYVTLFLLRANERAQDNAGVVAPFATRQTDWCRHTVRCTVRWQSINDYGRVMTEQTVDLT
RIH
Download sequence
Identical sequences Q57TN0
WP_001538897.1.15468 WP_001538897.1.17758 WP_001538897.1.22270 WP_001538897.1.32493 WP_001538897.1.36948 WP_001538897.1.44943 WP_001538897.1.50497 WP_001538897.1.50777 WP_001538897.1.5527 WP_001538897.1.57902 WP_001538897.1.60486 WP_001538897.1.71418 WP_001538897.1.76162 WP_001538897.1.99426 gi|62178595|ref|YP_215012.1| AE017220|CDS_30479-31210 321314.SC0025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]