SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62178767|ref|YP_215184.1| from Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62178767|ref|YP_215184.1|
Domain Number 1 Region: 27-144
Classification Level Classification E-value
Superfamily PapD-like 1.91e-35
Family Pilus chaperone 0.0000228
Further Details:      
 
Domain Number 2 Region: 152-242
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 2.62e-21
Family Periplasmic chaperone C-domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|62178767|ref|YP_215184.1|
Sequence length 250
Comment periplasmic fimbrial chaperone [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
Sequence
MMPLKRYNLAAVLLLLLGGYGSAQAAIAPDRTRLVFRGEDKSISVDLKNANSKLPYLAQS
WVEDEKGVKITSPLIVVPPAQRIEPSAIGQVKIQGMPALASLPKDRETLFYYNVREIPPQ
SDKPNTLQIALQTRIKVFYRPQALSKIDMQHPWQYKITLQRQGNGYQVSNPTGYYVVLSN
ASNRMDGTPARGFSPLVIAPKSNVTLGGDASELGHSPVLTYVNDYGARLPLIFNCTDNSC
AVDEAKSRKS
Download sequence
Identical sequences Q57T58
gi|62178767|ref|YP_215184.1| 321314.SC0197 AE017220|CDS_230085-230837 WP_011264191.1.15468 WP_011264191.1.17758 WP_011264191.1.22270 WP_011264191.1.32493 WP_011264191.1.36948 WP_011264191.1.44943 WP_011264191.1.50497 WP_011264191.1.50777 WP_011264191.1.5527 WP_011264191.1.57902 WP_011264191.1.60486 WP_011264191.1.71418 WP_011264191.1.76162 WP_011264191.1.99426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]