SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62178863|ref|YP_215280.1| from Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62178863|ref|YP_215280.1|
Domain Number 1 Region: 37-158
Classification Level Classification E-value
Superfamily PapD-like 2.88e-34
Family Pilus chaperone 0.000000493
Further Details:      
 
Domain Number 2 Region: 160-239
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 2.09e-22
Family Periplasmic chaperone C-domain 0.00000404
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|62178863|ref|YP_215280.1|
Sequence length 245
Comment fimbriae assembly chaperone [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
Sequence
MKIVNFAVMAVALFATNSMVSVYAVNQQLNSATKLFSVKLGATRVIYHAGTAGATLSVSN
PQNYPILVQSSVKAADKSSPAPFLVIPPLFRLEANQQSQLRIVRTGGDMPTDRETLQWVC
IKAVPPENEPSDTQAKGATLDLNLSINACDKLIFRPDAVKGTPEDVAGNLRWVETGNKLK
VENPTPFYMNLASVTVGGKPITGLEYVPPFADKTLNMPGSAHGDIEWRVITDFGGKSHPF
HYVLK
Download sequence
Identical sequences Q57SW2
321314.SC0293 gi|62178863|ref|YP_215280.1| AE017220|CDS_337447-338184 WP_011264198.1.22270 WP_011264198.1.32493 WP_011264198.1.36948 WP_011264198.1.44943 WP_011264198.1.50777 WP_011264198.1.57902 WP_011264198.1.60486 WP_011264198.1.76162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]