SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62178870|ref|YP_215287.1| from Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62178870|ref|YP_215287.1|
Domain Number 1 Region: 22-151
Classification Level Classification E-value
Superfamily PapD-like 0.00000000000471
Family Pilus chaperone 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|62178870|ref|YP_215287.1|
Sequence length 236
Comment fimbrial protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
Sequence
MNFKDTLPGVFLCVAMFACGHARANMLVYPMAAEINSSREEATSLFVYSKSDHVQYIRTR
IMRIEHPGMPQEKEVPAGNDIETGLVVSPEKFALSPGTKKTIRVISTQAPEREEAWRVYF
EAVPELEDDPQAGGKQNSSVSVNLVWGVLLRVSPSDPRPALVTNGHHLLNTGNTRLSLIR
AGNCDTTCHWQNIGKSIYPGGSADIPAGIKSNVFRVEYRTGANSPVISADLTAAGK
Download sequence
Identical sequences Q57SV5
321314.SC0300 gi|62178870|ref|YP_215287.1| WP_001539136.1.15468 WP_001539136.1.17758 WP_001539136.1.22270 WP_001539136.1.32493 WP_001539136.1.36948 WP_001539136.1.44943 WP_001539136.1.50497 WP_001539136.1.50777 WP_001539136.1.5527 WP_001539136.1.57902 WP_001539136.1.60486 WP_001539136.1.71418 WP_001539136.1.76162 WP_001539136.1.99426 AE017220|CDS_346343-347053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]