SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62181461|ref|YP_217878.1| from Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62181461|ref|YP_217878.1|
Domain Number 1 Region: 28-145
Classification Level Classification E-value
Superfamily PapD-like 1.94e-36
Family Pilus chaperone 0.0000399
Further Details:      
 
Domain Number 2 Region: 154-243
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 4.58e-20
Family Periplasmic chaperone C-domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|62181461|ref|YP_217878.1|
Sequence length 257
Comment periplasmic fimbrial chaperone [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
Sequence
MNKTNHFKRQALIASVLLAAPLVSHSAIVPDRTRVIFNGNENSITVTLKNGNATLPYLAQ
AWLEDDKFAKDTRYFTALPPLQRIEPKSDGQVKVQPLPAAASLPQDRESLFYFNVREIPP
KSDKPNTLQLALQTRIKFFYRPVAVARQVDKTHPWQTKLTLTYQGDGVIFDNPTPFYLVI
SNAGSKENETASGFKNLLIAPREKVTSPIKGASLGSSPVVGYVDDYGGHRLLVFTCSGNT
CKVNEEKTRDAEKKANK
Download sequence
Identical sequences A0A0G2NR52 A0A0H3BNM2 A0A0M0QVJ8 A0A0R9PGG8 A0A0T7RS56 A0A1U7FRT7 A0A221YPH4 A0A221Z9C4 A0A265B375 A0A271CXX0 A0A2K2ZN21 B5F4P4 B5RDT0 C0PXE1 M7S6P5 Q57KG5 S4ICH2 S5HP85 V7IFS0
gi|205353897|ref|YP_002227698.1| gi|194443504|ref|YP_002042202.1| gi|528820773|ref|YP_008361976.1| gi|538363532|ref|YP_008506817.1| gi|194451195|ref|YP_002046917.1| gi|525829204|ref|YP_008252257.1| 321314.SC2891 423368.SNSL254_A3173 439851.SeD_A3271 454166.SeAg_B3090 454169.SeHA_C3154 476213.SPC_3008 550537.SEN2796 550538.SG2861 gi|224584742|ref|YP_002638540.1| gi|207858217|ref|YP_002244868.1| gi|563654302|ref|YP_008862386.1| gi|62181461|ref|YP_217878.1| gi|197251395|ref|YP_002147859.1| gi|525814220|ref|YP_008244238.1| gi|386592641|ref|YP_006089041.1| ABAK02000001|CDS_2410000-2410773 ABAN01000004|CDS_111571-110798 ABEI01000005|CDS_135529-136302 ABEL01000005|CDS_123973-124746 AE017220|CDS_3058835-3059608 AM933172|CDS_2987814-2988587 AM933173|CDS_2978256-2979029 CP000857|CDS_3038394-3039167 CP001113|CDS_3083466-3084239 CP001120|CDS_3079397-3080170 CP001138|CDS_3015170-3015943 CP001144|CDS_3146877-3147650 gi|198243804|ref|YP_002216925.1| WP_001044459.1.100017 WP_001044459.1.100031 WP_001044459.1.100077 WP_001044459.1.100129 WP_001044459.1.10013 WP_001044459.1.100149 WP_001044459.1.100191 WP_001044459.1.100266 WP_001044459.1.100392 WP_001044459.1.100412 WP_001044459.1.100432 WP_001044459.1.100457 WP_001044459.1.100502 WP_001044459.1.100521 WP_001044459.1.100541 WP_001044459.1.100557 WP_001044459.1.100584 WP_001044459.1.100605 WP_001044459.1.10065 WP_001044459.1.100650 WP_001044459.1.100707 WP_001044459.1.100711 WP_001044459.1.100721 WP_001044459.1.100730 WP_001044459.1.10074 WP_001044459.1.100750 WP_001044459.1.100773 WP_001044459.1.100776 WP_001044459.1.100790 WP_001044459.1.10081 WP_001044459.1.100857 WP_001044459.1.100865 WP_001044459.1.100870 WP_001044459.1.100895 WP_001044459.1.100932 WP_001044459.1.100944 WP_001044459.1.101112 WP_001044459.1.101199 WP_001044459.1.1013 WP_001044459.1.101519 WP_001044459.1.101541 WP_001044459.1.101609 WP_001044459.1.101634 WP_001044459.1.101674 WP_001044459.1.101759 WP_001044459.1.101832 WP_001044459.1.101839 WP_001044459.1.101917 WP_001044459.1.101927 WP_001044459.1.101949 WP_001044459.1.102111 WP_001044459.1.10231 WP_001044459.1.10300 WP_001044459.1.10310 WP_001044459.1.10498 WP_001044459.1.10507 WP_001044459.1.10562 WP_001044459.1.10566 WP_001044459.1.10568 WP_001044459.1.10631 WP_001044459.1.10675 WP_001044459.1.10755 WP_001044459.1.10797 WP_001044459.1.10868 WP_001044459.1.10898 WP_001044459.1.1110 WP_001044459.1.11119 WP_001044459.1.11156 WP_001044459.1.11216 WP_001044459.1.11304 WP_001044459.1.1135 WP_001044459.1.11362 WP_001044459.1.11369 WP_001044459.1.1150 WP_001044459.1.11526 WP_001044459.1.11528 WP_001044459.1.1156 WP_001044459.1.11588 WP_001044459.1.11621 WP_001044459.1.11677 WP_001044459.1.11687 WP_001044459.1.1169 WP_001044459.1.11735 WP_001044459.1.1174 WP_001044459.1.11824 WP_001044459.1.11834 WP_001044459.1.11841 WP_001044459.1.11868 WP_001044459.1.11900 WP_001044459.1.11978 WP_001044459.1.12007 WP_001044459.1.12017 WP_001044459.1.12027 WP_001044459.1.12059 WP_001044459.1.12063 WP_001044459.1.12106 WP_001044459.1.1215 WP_001044459.1.12159 WP_001044459.1.12168 WP_001044459.1.12280 WP_001044459.1.12340 WP_001044459.1.12374 WP_001044459.1.1239 WP_001044459.1.12472 WP_001044459.1.12485 WP_001044459.1.1250 WP_001044459.1.12568 WP_001044459.1.12569 WP_001044459.1.12585 WP_001044459.1.12650 WP_001044459.1.12696 WP_001044459.1.1300 WP_001044459.1.13076 WP_001044459.1.13102 WP_001044459.1.13207 WP_001044459.1.13247 WP_001044459.1.1326 WP_001044459.1.13274 WP_001044459.1.13367 WP_001044459.1.13391 WP_001044459.1.1346 WP_001044459.1.13573 WP_001044459.1.13625 WP_001044459.1.13661 WP_001044459.1.13677 WP_001044459.1.13750 WP_001044459.1.13764 WP_001044459.1.13829 WP_001044459.1.13857 WP_001044459.1.14111 WP_001044459.1.1412 WP_001044459.1.14369 WP_001044459.1.1440 WP_001044459.1.14436 WP_001044459.1.14458 WP_001044459.1.14495 WP_001044459.1.14505 WP_001044459.1.14528 WP_001044459.1.146 WP_001044459.1.14618 WP_001044459.1.14688 WP_001044459.1.14708 WP_001044459.1.14793 WP_001044459.1.14808 WP_001044459.1.14819 WP_001044459.1.14913 WP_001044459.1.14917 WP_001044459.1.14964 WP_001044459.1.15046 WP_001044459.1.15059 WP_001044459.1.15067 WP_001044459.1.15214 WP_001044459.1.15276 WP_001044459.1.15318 WP_001044459.1.15468 WP_001044459.1.15479 WP_001044459.1.15483 WP_001044459.1.1551 WP_001044459.1.15585 WP_001044459.1.15612 WP_001044459.1.15625 WP_001044459.1.15637 WP_001044459.1.1568 WP_001044459.1.15708 WP_001044459.1.15775 WP_001044459.1.15777 WP_001044459.1.15835 WP_001044459.1.15862 WP_001044459.1.15910 WP_001044459.1.15978 WP_001044459.1.15986 WP_001044459.1.16000 WP_001044459.1.16004 WP_001044459.1.16032 WP_001044459.1.16047 WP_001044459.1.16052 WP_001044459.1.1611 WP_001044459.1.16125 WP_001044459.1.16158 WP_001044459.1.16273 WP_001044459.1.16331 WP_001044459.1.16361 WP_001044459.1.16363 WP_001044459.1.16365 WP_001044459.1.16366 WP_001044459.1.16394 WP_001044459.1.16453 WP_001044459.1.16474 WP_001044459.1.16508 WP_001044459.1.16525 WP_001044459.1.16565 WP_001044459.1.16656 WP_001044459.1.16729 WP_001044459.1.16826 WP_001044459.1.16846 WP_001044459.1.16873 WP_001044459.1.1689 WP_001044459.1.16903 WP_001044459.1.16910 WP_001044459.1.16941 WP_001044459.1.16944 WP_001044459.1.16949 WP_001044459.1.16972 WP_001044459.1.17031 WP_001044459.1.17060 WP_001044459.1.17093 WP_001044459.1.17096 WP_001044459.1.17105 WP_001044459.1.17188 WP_001044459.1.17285 WP_001044459.1.1733 WP_001044459.1.1737 WP_001044459.1.17390 WP_001044459.1.17447 WP_001044459.1.17482 WP_001044459.1.1749 WP_001044459.1.17525 WP_001044459.1.17583 WP_001044459.1.17629 WP_001044459.1.17732 WP_001044459.1.17743 WP_001044459.1.17755 WP_001044459.1.17758 WP_001044459.1.17886 WP_001044459.1.17891 WP_001044459.1.17914 WP_001044459.1.17919 WP_001044459.1.17936 WP_001044459.1.17949 WP_001044459.1.1798 WP_001044459.1.17991 WP_001044459.1.18056 WP_001044459.1.18061 WP_001044459.1.18089 WP_001044459.1.18092 WP_001044459.1.18109 WP_001044459.1.18122 WP_001044459.1.1814 WP_001044459.1.18149 WP_001044459.1.1818 WP_001044459.1.18254 WP_001044459.1.18384 WP_001044459.1.18426 WP_001044459.1.18445 WP_001044459.1.18641 WP_001044459.1.18686 WP_001044459.1.18692 WP_001044459.1.18737 WP_001044459.1.18847 WP_001044459.1.18886 WP_001044459.1.18919 WP_001044459.1.1895 WP_001044459.1.1897 WP_001044459.1.19038 WP_001044459.1.19093 WP_001044459.1.19240 WP_001044459.1.19273 WP_001044459.1.19291 WP_001044459.1.19373 WP_001044459.1.1939 WP_001044459.1.19433 WP_001044459.1.19469 WP_001044459.1.1955 WP_001044459.1.19588 WP_001044459.1.19616 WP_001044459.1.19656 WP_001044459.1.19683 WP_001044459.1.19793 WP_001044459.1.19834 WP_001044459.1.19938 WP_001044459.1.19975 WP_001044459.1.20034 WP_001044459.1.20081 WP_001044459.1.20086 WP_001044459.1.20261 WP_001044459.1.20391 WP_001044459.1.2041 WP_001044459.1.20425 WP_001044459.1.20437 WP_001044459.1.20446 WP_001044459.1.2047 WP_001044459.1.20614 WP_001044459.1.20695 WP_001044459.1.20700 WP_001044459.1.20767 WP_001044459.1.20789 WP_001044459.1.20795 WP_001044459.1.21075 WP_001044459.1.21079 WP_001044459.1.21103 WP_001044459.1.21136 WP_001044459.1.2116 WP_001044459.1.21194 WP_001044459.1.21202 WP_001044459.1.21241 WP_001044459.1.21286 WP_001044459.1.21332 WP_001044459.1.21351 WP_001044459.1.21399 WP_001044459.1.21404 WP_001044459.1.21443 WP_001044459.1.21616 WP_001044459.1.21681 WP_001044459.1.21715 WP_001044459.1.21792 WP_001044459.1.21886 WP_001044459.1.21909 WP_001044459.1.21910 WP_001044459.1.21950 WP_001044459.1.21991 WP_001044459.1.22030 WP_001044459.1.22051 WP_001044459.1.22096 WP_001044459.1.22136 WP_001044459.1.22158 WP_001044459.1.22162 WP_001044459.1.22205 WP_001044459.1.22235 WP_001044459.1.2224 WP_001044459.1.22240 WP_001044459.1.22270 WP_001044459.1.22296 WP_001044459.1.22337 WP_001044459.1.22346 WP_001044459.1.22449 WP_001044459.1.22454 WP_001044459.1.22460 WP_001044459.1.22514 WP_001044459.1.22565 WP_001044459.1.22575 WP_001044459.1.22590 WP_001044459.1.22595 WP_001044459.1.22605 WP_001044459.1.22623 WP_001044459.1.22692 WP_001044459.1.22758 WP_001044459.1.22760 WP_001044459.1.22857 WP_001044459.1.22864 WP_001044459.1.22880 WP_001044459.1.22902 WP_001044459.1.22947 WP_001044459.1.23080 WP_001044459.1.23148 WP_001044459.1.23155 WP_001044459.1.23175 WP_001044459.1.2324 WP_001044459.1.23258 WP_001044459.1.23274 WP_001044459.1.23309 WP_001044459.1.23311 WP_001044459.1.23329 WP_001044459.1.23343 WP_001044459.1.23379 WP_001044459.1.23442 WP_001044459.1.23466 WP_001044459.1.23500 WP_001044459.1.23509 WP_001044459.1.2358 WP_001044459.1.23621 WP_001044459.1.23631 WP_001044459.1.23670 WP_001044459.1.23675 WP_001044459.1.237 WP_001044459.1.23720 WP_001044459.1.23736 WP_001044459.1.2380 WP_001044459.1.23819 WP_001044459.1.23959 WP_001044459.1.24082 WP_001044459.1.24145 WP_001044459.1.24163 WP_001044459.1.24214 WP_001044459.1.24250 WP_001044459.1.24297 WP_001044459.1.24325 WP_001044459.1.24361 WP_001044459.1.24408 WP_001044459.1.24409 WP_001044459.1.24433 WP_001044459.1.24444 WP_001044459.1.24476 WP_001044459.1.24494 WP_001044459.1.24673 WP_001044459.1.24686 WP_001044459.1.24689 WP_001044459.1.24696 WP_001044459.1.24803 WP_001044459.1.24837 WP_001044459.1.24839 WP_001044459.1.24901 WP_001044459.1.24944 WP_001044459.1.25064 WP_001044459.1.25072 WP_001044459.1.25119 WP_001044459.1.25130 WP_001044459.1.25159 WP_001044459.1.25175 WP_001044459.1.25205 WP_001044459.1.25354 WP_001044459.1.25421 WP_001044459.1.25426 WP_001044459.1.25498 WP_001044459.1.25514 WP_001044459.1.2554 WP_001044459.1.25546 WP_001044459.1.25564 WP_001044459.1.25618 WP_001044459.1.2568 WP_001044459.1.25700 WP_001044459.1.25703 WP_001044459.1.25709 WP_001044459.1.25722 WP_001044459.1.25780 WP_001044459.1.25809 WP_001044459.1.25825 WP_001044459.1.25932 WP_001044459.1.25951 WP_001044459.1.26083 WP_001044459.1.26194 WP_001044459.1.26269 WP_001044459.1.26363 WP_001044459.1.26384 WP_001044459.1.26426 WP_001044459.1.26441 WP_001044459.1.26532 WP_001044459.1.26576 WP_001044459.1.26582 WP_001044459.1.26587 WP_001044459.1.26687 WP_001044459.1.2672 WP_001044459.1.26741 WP_001044459.1.26787 WP_001044459.1.26794 WP_001044459.1.26856 WP_001044459.1.26883 WP_001044459.1.26892 WP_001044459.1.26919 WP_001044459.1.26936 WP_001044459.1.27084 WP_001044459.1.272 WP_001044459.1.27223 WP_001044459.1.2723 WP_001044459.1.27272 WP_001044459.1.27279 WP_001044459.1.27314 WP_001044459.1.27383 WP_001044459.1.27419 WP_001044459.1.27452 WP_001044459.1.27535 WP_001044459.1.27544 WP_001044459.1.27547 WP_001044459.1.27632 WP_001044459.1.27638 WP_001044459.1.27658 WP_001044459.1.27755 WP_001044459.1.27800 WP_001044459.1.27815 WP_001044459.1.27833 WP_001044459.1.27883 WP_001044459.1.27995 WP_001044459.1.28002 WP_001044459.1.28032 WP_001044459.1.28037 WP_001044459.1.28056 WP_001044459.1.28073 WP_001044459.1.28139 WP_001044459.1.28200 WP_001044459.1.28225 WP_001044459.1.28232 WP_001044459.1.28233 WP_001044459.1.28267 WP_001044459.1.28303 WP_001044459.1.28462 WP_001044459.1.2853 WP_001044459.1.28570 WP_001044459.1.28612 WP_001044459.1.28620 WP_001044459.1.28673 WP_001044459.1.287 WP_001044459.1.28733 WP_001044459.1.28773 WP_001044459.1.28776 WP_001044459.1.28811 WP_001044459.1.28830 WP_001044459.1.28902 WP_001044459.1.28977 WP_001044459.1.29113 WP_001044459.1.29130 WP_001044459.1.29168 WP_001044459.1.29218 WP_001044459.1.2924 WP_001044459.1.29274 WP_001044459.1.2932 WP_001044459.1.29379 WP_001044459.1.29422 WP_001044459.1.29436 WP_001044459.1.29509 WP_001044459.1.29576 WP_001044459.1.29732 WP_001044459.1.29775 WP_001044459.1.29827 WP_001044459.1.2984 WP_001044459.1.29845 WP_001044459.1.29924 WP_001044459.1.29990 WP_001044459.1.30022 WP_001044459.1.3005 WP_001044459.1.30059 WP_001044459.1.30165 WP_001044459.1.3017 WP_001044459.1.30170 WP_001044459.1.30195 WP_001044459.1.30202 WP_001044459.1.30210 WP_001044459.1.30278 WP_001044459.1.30331 WP_001044459.1.30386 WP_001044459.1.30425 WP_001044459.1.30437 WP_001044459.1.30492 WP_001044459.1.30548 WP_001044459.1.30573 WP_001044459.1.30589 WP_001044459.1.30602 WP_001044459.1.30627 WP_001044459.1.3067 WP_001044459.1.30696 WP_001044459.1.30752 WP_001044459.1.30823 WP_001044459.1.30909 WP_001044459.1.30968 WP_001044459.1.31011 WP_001044459.1.31092 WP_001044459.1.31107 WP_001044459.1.31122 WP_001044459.1.31155 WP_001044459.1.31167 WP_001044459.1.31198 WP_001044459.1.31210 WP_001044459.1.31214 WP_001044459.1.3124 WP_001044459.1.31251 WP_001044459.1.3127 WP_001044459.1.31272 WP_001044459.1.31335 WP_001044459.1.31435 WP_001044459.1.31451 WP_001044459.1.31476 WP_001044459.1.31585 WP_001044459.1.3167 WP_001044459.1.3170 WP_001044459.1.31895 WP_001044459.1.31901 WP_001044459.1.31983 WP_001044459.1.32056 WP_001044459.1.32109 WP_001044459.1.32170 WP_001044459.1.32252 WP_001044459.1.32255 WP_001044459.1.32260 WP_001044459.1.32274 WP_001044459.1.32277 WP_001044459.1.32309 WP_001044459.1.32368 WP_001044459.1.32493 WP_001044459.1.32519 WP_001044459.1.32545 WP_001044459.1.32668 WP_001044459.1.32740 WP_001044459.1.32747 WP_001044459.1.3278 WP_001044459.1.32832 WP_001044459.1.32881 WP_001044459.1.32899 WP_001044459.1.32930 WP_001044459.1.32961 WP_001044459.1.32977 WP_001044459.1.33160 WP_001044459.1.33253 WP_001044459.1.33270 WP_001044459.1.33409 WP_001044459.1.335 WP_001044459.1.3356 WP_001044459.1.33580 WP_001044459.1.33586 WP_001044459.1.33609 WP_001044459.1.3364 WP_001044459.1.33659 WP_001044459.1.33693 WP_001044459.1.33865 WP_001044459.1.33870 WP_001044459.1.3394 WP_001044459.1.3396 WP_001044459.1.34 WP_001044459.1.34084 WP_001044459.1.34091 WP_001044459.1.34107 WP_001044459.1.34185 WP_001044459.1.34292 WP_001044459.1.3438 WP_001044459.1.34417 WP_001044459.1.34431 WP_001044459.1.34454 WP_001044459.1.34614 WP_001044459.1.34684 WP_001044459.1.34703 WP_001044459.1.34707 WP_001044459.1.34711 WP_001044459.1.3476 WP_001044459.1.34801 WP_001044459.1.34817 WP_001044459.1.34820 WP_001044459.1.34881 WP_001044459.1.35193 WP_001044459.1.35298 WP_001044459.1.35321 WP_001044459.1.35332 WP_001044459.1.3541 WP_001044459.1.35460 WP_001044459.1.35494 WP_001044459.1.35563 WP_001044459.1.35570 WP_001044459.1.35594 WP_001044459.1.35619 WP_001044459.1.35624 WP_001044459.1.3572 WP_001044459.1.35777 WP_001044459.1.35835 WP_001044459.1.35887 WP_001044459.1.35892 WP_001044459.1.35936 WP_001044459.1.35961 WP_001044459.1.36011 WP_001044459.1.36017 WP_001044459.1.36037 WP_001044459.1.36063 WP_001044459.1.36157 WP_001044459.1.36172 WP_001044459.1.36229 WP_001044459.1.36409 WP_001044459.1.36445 WP_001044459.1.36512 WP_001044459.1.36542 WP_001044459.1.36547 WP_001044459.1.36584 WP_001044459.1.36685 WP_001044459.1.36721 WP_001044459.1.36751 WP_001044459.1.36764 WP_001044459.1.36839 WP_001044459.1.36885 WP_001044459.1.36889 WP_001044459.1.36948 WP_001044459.1.37021 WP_001044459.1.37029 WP_001044459.1.37114 WP_001044459.1.37147 WP_001044459.1.37158 WP_001044459.1.37190 WP_001044459.1.37191 WP_001044459.1.3726 WP_001044459.1.3728 WP_001044459.1.37297 WP_001044459.1.37320 WP_001044459.1.37351 WP_001044459.1.37405 WP_001044459.1.3748 WP_001044459.1.3751 WP_001044459.1.37558 WP_001044459.1.37610 WP_001044459.1.37666 WP_001044459.1.3771 WP_001044459.1.3778 WP_001044459.1.37864 WP_001044459.1.3790 WP_001044459.1.37965 WP_001044459.1.38037 WP_001044459.1.38047 WP_001044459.1.38055 WP_001044459.1.38113 WP_001044459.1.38199 WP_001044459.1.3828 WP_001044459.1.38322 WP_001044459.1.38344 WP_001044459.1.38349 WP_001044459.1.38408 WP_001044459.1.38512 WP_001044459.1.38569 WP_001044459.1.38609 WP_001044459.1.38622 WP_001044459.1.38740 WP_001044459.1.38781 WP_001044459.1.38830 WP_001044459.1.3891 WP_001044459.1.38995 WP_001044459.1.39048 WP_001044459.1.39055 WP_001044459.1.39065 WP_001044459.1.39128 WP_001044459.1.39140 WP_001044459.1.39265 WP_001044459.1.39275 WP_001044459.1.39312 WP_001044459.1.39395 WP_001044459.1.39414 WP_001044459.1.39497 WP_001044459.1.39503 WP_001044459.1.39584 WP_001044459.1.39614 WP_001044459.1.39724 WP_001044459.1.39808 WP_001044459.1.40025 WP_001044459.1.40081 WP_001044459.1.40158 WP_001044459.1.40284 WP_001044459.1.40307 WP_001044459.1.40341 WP_001044459.1.40492 WP_001044459.1.40493 WP_001044459.1.40528 WP_001044459.1.40533 WP_001044459.1.40577 WP_001044459.1.40622 WP_001044459.1.40695 WP_001044459.1.40722 WP_001044459.1.40745 WP_001044459.1.40771 WP_001044459.1.40788 WP_001044459.1.40849 WP_001044459.1.40910 WP_001044459.1.40930 WP_001044459.1.40935 WP_001044459.1.40973 WP_001044459.1.40996 WP_001044459.1.41018 WP_001044459.1.4109 WP_001044459.1.41116 WP_001044459.1.41128 WP_001044459.1.41192 WP_001044459.1.41265 WP_001044459.1.41277 WP_001044459.1.41308 WP_001044459.1.41310 WP_001044459.1.4141 WP_001044459.1.41427 WP_001044459.1.41434 WP_001044459.1.41440 WP_001044459.1.41528 WP_001044459.1.41593 WP_001044459.1.41610 WP_001044459.1.41628 WP_001044459.1.41690 WP_001044459.1.41724 WP_001044459.1.41799 WP_001044459.1.4184 WP_001044459.1.41862 WP_001044459.1.41904 WP_001044459.1.41911 WP_001044459.1.41931 WP_001044459.1.41949 WP_001044459.1.41978 WP_001044459.1.41998 WP_001044459.1.42009 WP_001044459.1.42109 WP_001044459.1.42136 WP_001044459.1.42156 WP_001044459.1.422 WP_001044459.1.4222 WP_001044459.1.42238 WP_001044459.1.42243 WP_001044459.1.42244 WP_001044459.1.42263 WP_001044459.1.42322 WP_001044459.1.42392 WP_001044459.1.42404 WP_001044459.1.42433 WP_001044459.1.42444 WP_001044459.1.42453 WP_001044459.1.4257 WP_001044459.1.42655 WP_001044459.1.42666 WP_001044459.1.42675 WP_001044459.1.42676 WP_001044459.1.42683 WP_001044459.1.42734 WP_001044459.1.42794 WP_001044459.1.42797 WP_001044459.1.42829 WP_001044459.1.42887 WP_001044459.1.42892 WP_001044459.1.42932 WP_001044459.1.43077 WP_001044459.1.43086 WP_001044459.1.43160 WP_001044459.1.43201 WP_001044459.1.43272 WP_001044459.1.43339 WP_001044459.1.43371 WP_001044459.1.4344 WP_001044459.1.43476 WP_001044459.1.43520 WP_001044459.1.43535 WP_001044459.1.43606 WP_001044459.1.43676 WP_001044459.1.43685 WP_001044459.1.43711 WP_001044459.1.4373 WP_001044459.1.43778 WP_001044459.1.43785 WP_001044459.1.43828 WP_001044459.1.43839 WP_001044459.1.43864 WP_001044459.1.43875 WP_001044459.1.43951 WP_001044459.1.44010 WP_001044459.1.4405 WP_001044459.1.44191 WP_001044459.1.44250 WP_001044459.1.44300 WP_001044459.1.44337 WP_001044459.1.44359 WP_001044459.1.44397 WP_001044459.1.4440 WP_001044459.1.44433 WP_001044459.1.44438 WP_001044459.1.44440 WP_001044459.1.44453 WP_001044459.1.44474 WP_001044459.1.44593 WP_001044459.1.44607 WP_001044459.1.44636 WP_001044459.1.44702 WP_001044459.1.44705 WP_001044459.1.44781 WP_001044459.1.44831 WP_001044459.1.44887 WP_001044459.1.44933 WP_001044459.1.44943 WP_001044459.1.44966 WP_001044459.1.44978 WP_001044459.1.44997 WP_001044459.1.44998 WP_001044459.1.4500 WP_001044459.1.45027 WP_001044459.1.45038 WP_001044459.1.45123 WP_001044459.1.45134 WP_001044459.1.45145 WP_001044459.1.45173 WP_001044459.1.45229 WP_001044459.1.45302 WP_001044459.1.4531 WP_001044459.1.45432 WP_001044459.1.45434 WP_001044459.1.45522 WP_001044459.1.45535 WP_001044459.1.45549 WP_001044459.1.45569 WP_001044459.1.45571 WP_001044459.1.45582 WP_001044459.1.45583 WP_001044459.1.45622 WP_001044459.1.45706 WP_001044459.1.45844 WP_001044459.1.45848 WP_001044459.1.45906 WP_001044459.1.45918 WP_001044459.1.4592 WP_001044459.1.46028 WP_001044459.1.46091 WP_001044459.1.46203 WP_001044459.1.46215 WP_001044459.1.46232 WP_001044459.1.46278 WP_001044459.1.46358 WP_001044459.1.46434 WP_001044459.1.46578 WP_001044459.1.46637 WP_001044459.1.46726 WP_001044459.1.46730 WP_001044459.1.4674 WP_001044459.1.46749 WP_001044459.1.46804 WP_001044459.1.4686 WP_001044459.1.46961 WP_001044459.1.46967 WP_001044459.1.46976 WP_001044459.1.47008 WP_001044459.1.47442 WP_001044459.1.47460 WP_001044459.1.47507 WP_001044459.1.47567 WP_001044459.1.47576 WP_001044459.1.47579 WP_001044459.1.4758 WP_001044459.1.47614 WP_001044459.1.47714 WP_001044459.1.47767 WP_001044459.1.47829 WP_001044459.1.47850 WP_001044459.1.47875 WP_001044459.1.47911 WP_001044459.1.4795 WP_001044459.1.47988 WP_001044459.1.47992 WP_001044459.1.48215 WP_001044459.1.48268 WP_001044459.1.4839 WP_001044459.1.48493 WP_001044459.1.48751 WP_001044459.1.48755 WP_001044459.1.48774 WP_001044459.1.48797 WP_001044459.1.48886 WP_001044459.1.48918 WP_001044459.1.48931 WP_001044459.1.49102 WP_001044459.1.49113 WP_001044459.1.49175 WP_001044459.1.49214 WP_001044459.1.49226 WP_001044459.1.49233 WP_001044459.1.49304 WP_001044459.1.49311 WP_001044459.1.49334 WP_001044459.1.49375 WP_001044459.1.49574 WP_001044459.1.49602 WP_001044459.1.49626 WP_001044459.1.49686 WP_001044459.1.49770 WP_001044459.1.49780 WP_001044459.1.49827 WP_001044459.1.49931 WP_001044459.1.50 WP_001044459.1.50007 WP_001044459.1.5009 WP_001044459.1.50128 WP_001044459.1.50285 WP_001044459.1.50332 WP_001044459.1.50404 WP_001044459.1.50413 WP_001044459.1.50449 WP_001044459.1.50469 WP_001044459.1.50478 WP_001044459.1.50497 WP_001044459.1.50563 WP_001044459.1.5058 WP_001044459.1.50652 WP_001044459.1.50684 WP_001044459.1.50777 WP_001044459.1.50800 WP_001044459.1.50882 WP_001044459.1.50905 WP_001044459.1.50954 WP_001044459.1.50960 WP_001044459.1.50999 WP_001044459.1.51036 WP_001044459.1.51066 WP_001044459.1.51117 WP_001044459.1.5114 WP_001044459.1.51162 WP_001044459.1.51224 WP_001044459.1.5125 WP_001044459.1.51338 WP_001044459.1.51356 WP_001044459.1.51412 WP_001044459.1.51414 WP_001044459.1.51419 WP_001044459.1.51451 WP_001044459.1.51502 WP_001044459.1.51506 WP_001044459.1.51611 WP_001044459.1.51642 WP_001044459.1.51704 WP_001044459.1.51764 WP_001044459.1.51810 WP_001044459.1.51831 WP_001044459.1.51868 WP_001044459.1.51888 WP_001044459.1.51910 WP_001044459.1.51930 WP_001044459.1.51994 WP_001044459.1.520 WP_001044459.1.5211 WP_001044459.1.52123 WP_001044459.1.52156 WP_001044459.1.52170 WP_001044459.1.52255 WP_001044459.1.52301 WP_001044459.1.52321 WP_001044459.1.52336 WP_001044459.1.52582 WP_001044459.1.52586 WP_001044459.1.52692 WP_001044459.1.52748 WP_001044459.1.52833 WP_001044459.1.52866 WP_001044459.1.52924 WP_001044459.1.52949 WP_001044459.1.52985 WP_001044459.1.53100 WP_001044459.1.53107 WP_001044459.1.53119 WP_001044459.1.5313 WP_001044459.1.53158 WP_001044459.1.5316 WP_001044459.1.53198 WP_001044459.1.53203 WP_001044459.1.53206 WP_001044459.1.53234 WP_001044459.1.53272 WP_001044459.1.53315 WP_001044459.1.53316 WP_001044459.1.53362 WP_001044459.1.53385 WP_001044459.1.53567 WP_001044459.1.53664 WP_001044459.1.53675 WP_001044459.1.53694 WP_001044459.1.53778 WP_001044459.1.53781 WP_001044459.1.53814 WP_001044459.1.53896 WP_001044459.1.53905 WP_001044459.1.5392 WP_001044459.1.53961 WP_001044459.1.54061 WP_001044459.1.54082 WP_001044459.1.5415 WP_001044459.1.54283 WP_001044459.1.54333 WP_001044459.1.54366 WP_001044459.1.54469 WP_001044459.1.54526 WP_001044459.1.54615 WP_001044459.1.54827 WP_001044459.1.54833 WP_001044459.1.54877 WP_001044459.1.54936 WP_001044459.1.55166 WP_001044459.1.5517 WP_001044459.1.55178 WP_001044459.1.55223 WP_001044459.1.55224 WP_001044459.1.5523 WP_001044459.1.5527 WP_001044459.1.55325 WP_001044459.1.55418 WP_001044459.1.55430 WP_001044459.1.55477 WP_001044459.1.55496 WP_001044459.1.55559 WP_001044459.1.5560 WP_001044459.1.55623 WP_001044459.1.55640 WP_001044459.1.55672 WP_001044459.1.55706 WP_001044459.1.55718 WP_001044459.1.5572 WP_001044459.1.5577 WP_001044459.1.55803 WP_001044459.1.55853 WP_001044459.1.55923 WP_001044459.1.55948 WP_001044459.1.55973 WP_001044459.1.56004 WP_001044459.1.56059 WP_001044459.1.56082 WP_001044459.1.56097 WP_001044459.1.56235 WP_001044459.1.56244 WP_001044459.1.56247 WP_001044459.1.56263 WP_001044459.1.56303 WP_001044459.1.56354 WP_001044459.1.56370 WP_001044459.1.56385 WP_001044459.1.56393 WP_001044459.1.56468 WP_001044459.1.56512 WP_001044459.1.56559 WP_001044459.1.56615 WP_001044459.1.56660 WP_001044459.1.5668 WP_001044459.1.56851 WP_001044459.1.56861 WP_001044459.1.56898 WP_001044459.1.56950 WP_001044459.1.57026 WP_001044459.1.57039 WP_001044459.1.57056 WP_001044459.1.57076 WP_001044459.1.5711 WP_001044459.1.57125 WP_001044459.1.57143 WP_001044459.1.57149 WP_001044459.1.57233 WP_001044459.1.57246 WP_001044459.1.57296 WP_001044459.1.57344 WP_001044459.1.57356 WP_001044459.1.57357 WP_001044459.1.57362 WP_001044459.1.57494 WP_001044459.1.57521 WP_001044459.1.5753 WP_001044459.1.57559 WP_001044459.1.57631 WP_001044459.1.57641 WP_001044459.1.57709 WP_001044459.1.5774 WP_001044459.1.57797 WP_001044459.1.57835 WP_001044459.1.57893 WP_001044459.1.57902 WP_001044459.1.58090 WP_001044459.1.58131 WP_001044459.1.58153 WP_001044459.1.58239 WP_001044459.1.58249 WP_001044459.1.5828 WP_001044459.1.58290 WP_001044459.1.58301 WP_001044459.1.58357 WP_001044459.1.58358 WP_001044459.1.58407 WP_001044459.1.58416 WP_001044459.1.58442 WP_001044459.1.58443 WP_001044459.1.5846 WP_001044459.1.58486 WP_001044459.1.58489 WP_001044459.1.58564 WP_001044459.1.58675 WP_001044459.1.58698 WP_001044459.1.587 WP_001044459.1.58749 WP_001044459.1.58831 WP_001044459.1.58836 WP_001044459.1.58861 WP_001044459.1.58884 WP_001044459.1.58926 WP_001044459.1.58932 WP_001044459.1.59006 WP_001044459.1.59142 WP_001044459.1.59148 WP_001044459.1.59163 WP_001044459.1.5929 WP_001044459.1.59335 WP_001044459.1.59412 WP_001044459.1.59420 WP_001044459.1.59427 WP_001044459.1.59521 WP_001044459.1.59538 WP_001044459.1.59548 WP_001044459.1.59636 WP_001044459.1.59646 WP_001044459.1.59710 WP_001044459.1.59848 WP_001044459.1.59928 WP_001044459.1.59979 WP_001044459.1.60004 WP_001044459.1.60126 WP_001044459.1.60137 WP_001044459.1.60226 WP_001044459.1.60320 WP_001044459.1.6033 WP_001044459.1.60425 WP_001044459.1.60503 WP_001044459.1.60545 WP_001044459.1.60561 WP_001044459.1.60622 WP_001044459.1.60713 WP_001044459.1.60746 WP_001044459.1.60760 WP_001044459.1.60772 WP_001044459.1.608 WP_001044459.1.60838 WP_001044459.1.6086 WP_001044459.1.60863 WP_001044459.1.60866 WP_001044459.1.60897 WP_001044459.1.60926 WP_001044459.1.60976 WP_001044459.1.61045 WP_001044459.1.61114 WP_001044459.1.61146 WP_001044459.1.61233 WP_001044459.1.61356 WP_001044459.1.61381 WP_001044459.1.61497 WP_001044459.1.61501 WP_001044459.1.61582 WP_001044459.1.61594 WP_001044459.1.61595 WP_001044459.1.61671 WP_001044459.1.61732 WP_001044459.1.61743 WP_001044459.1.61908 WP_001044459.1.61922 WP_001044459.1.61968 WP_001044459.1.62020 WP_001044459.1.6209 WP_001044459.1.6210 WP_001044459.1.62120 WP_001044459.1.62122 WP_001044459.1.62144 WP_001044459.1.62158 WP_001044459.1.62201 WP_001044459.1.62210 WP_001044459.1.62219 WP_001044459.1.62241 WP_001044459.1.62245 WP_001044459.1.62257 WP_001044459.1.62412 WP_001044459.1.62486 WP_001044459.1.62522 WP_001044459.1.62564 WP_001044459.1.62648 WP_001044459.1.62693 WP_001044459.1.627 WP_001044459.1.62745 WP_001044459.1.62757 WP_001044459.1.62798 WP_001044459.1.6292 WP_001044459.1.62976 WP_001044459.1.62983 WP_001044459.1.62988 WP_001044459.1.63043 WP_001044459.1.63045 WP_001044459.1.63102 WP_001044459.1.63118 WP_001044459.1.63135 WP_001044459.1.63229 WP_001044459.1.63234 WP_001044459.1.63250 WP_001044459.1.63358 WP_001044459.1.63422 WP_001044459.1.63455 WP_001044459.1.63497 WP_001044459.1.63499 WP_001044459.1.63509 WP_001044459.1.63529 WP_001044459.1.63532 WP_001044459.1.63568 WP_001044459.1.6357 WP_001044459.1.63585 WP_001044459.1.63603 WP_001044459.1.63690 WP_001044459.1.6370 WP_001044459.1.63748 WP_001044459.1.63781 WP_001044459.1.63797 WP_001044459.1.63824 WP_001044459.1.63851 WP_001044459.1.63860 WP_001044459.1.63863 WP_001044459.1.63866 WP_001044459.1.63903 WP_001044459.1.63912 WP_001044459.1.63958 WP_001044459.1.63977 WP_001044459.1.63992 WP_001044459.1.64010 WP_001044459.1.64018 WP_001044459.1.64034 WP_001044459.1.64085 WP_001044459.1.64109 WP_001044459.1.64121 WP_001044459.1.64157 WP_001044459.1.64217 WP_001044459.1.64229 WP_001044459.1.64242 WP_001044459.1.64350 WP_001044459.1.64374 WP_001044459.1.64385 WP_001044459.1.64387 WP_001044459.1.64412 WP_001044459.1.64462 WP_001044459.1.64500 WP_001044459.1.6451 WP_001044459.1.64569 WP_001044459.1.64597 WP_001044459.1.64674 WP_001044459.1.64711 WP_001044459.1.64894 WP_001044459.1.64919 WP_001044459.1.64977 WP_001044459.1.65011 WP_001044459.1.65016 WP_001044459.1.65052 WP_001044459.1.65269 WP_001044459.1.65348 WP_001044459.1.65357 WP_001044459.1.65394 WP_001044459.1.65437 WP_001044459.1.65601 WP_001044459.1.65698 WP_001044459.1.65771 WP_001044459.1.65838 WP_001044459.1.65881 WP_001044459.1.65883 WP_001044459.1.65901 WP_001044459.1.65940 WP_001044459.1.6595 WP_001044459.1.65956 WP_001044459.1.66049 WP_001044459.1.66122 WP_001044459.1.66167 WP_001044459.1.66171 WP_001044459.1.66272 WP_001044459.1.66289 WP_001044459.1.66315 WP_001044459.1.66330 WP_001044459.1.66368 WP_001044459.1.66385 WP_001044459.1.66400 WP_001044459.1.66428 WP_001044459.1.66446 WP_001044459.1.66492 WP_001044459.1.66534 WP_001044459.1.66539 WP_001044459.1.66630 WP_001044459.1.66678 WP_001044459.1.66733 WP_001044459.1.66779 WP_001044459.1.66807 WP_001044459.1.66825 WP_001044459.1.6692 WP_001044459.1.66937 WP_001044459.1.66959 WP_001044459.1.67075 WP_001044459.1.6710 WP_001044459.1.67100 WP_001044459.1.67173 WP_001044459.1.67184 WP_001044459.1.67235 WP_001044459.1.67279 WP_001044459.1.67374 WP_001044459.1.6739 WP_001044459.1.67424 WP_001044459.1.6760 WP_001044459.1.67617 WP_001044459.1.67633 WP_001044459.1.67637 WP_001044459.1.67707 WP_001044459.1.67814 WP_001044459.1.6782 WP_001044459.1.6785 WP_001044459.1.67905 WP_001044459.1.67932 WP_001044459.1.67969 WP_001044459.1.68036 WP_001044459.1.68140 WP_001044459.1.68159 WP_001044459.1.6833 WP_001044459.1.68401 WP_001044459.1.68477 WP_001044459.1.68478 WP_001044459.1.68652 WP_001044459.1.68677 WP_001044459.1.6869 WP_001044459.1.68816 WP_001044459.1.68818 WP_001044459.1.68893 WP_001044459.1.68895 WP_001044459.1.69001 WP_001044459.1.6904 WP_001044459.1.6907 WP_001044459.1.69080 WP_001044459.1.69086 WP_001044459.1.69131 WP_001044459.1.69151 WP_001044459.1.69236 WP_001044459.1.69273 WP_001044459.1.69288 WP_001044459.1.69296 WP_001044459.1.69357 WP_001044459.1.69359 WP_001044459.1.69485 WP_001044459.1.6954 WP_001044459.1.69554 WP_001044459.1.69575 WP_001044459.1.69616 WP_001044459.1.69696 WP_001044459.1.69710 WP_001044459.1.69758 WP_001044459.1.69760 WP_001044459.1.69767 WP_001044459.1.69790 WP_001044459.1.69890 WP_001044459.1.69965 WP_001044459.1.70003 WP_001044459.1.70047 WP_001044459.1.70088 WP_001044459.1.7010 WP_001044459.1.7014 WP_001044459.1.7016 WP_001044459.1.70169 WP_001044459.1.70248 WP_001044459.1.70272 WP_001044459.1.70303 WP_001044459.1.70326 WP_001044459.1.70327 WP_001044459.1.70440 WP_001044459.1.70491 WP_001044459.1.70523 WP_001044459.1.70531 WP_001044459.1.70547 WP_001044459.1.70596 WP_001044459.1.70678 WP_001044459.1.70733 WP_001044459.1.70761 WP_001044459.1.70785 WP_001044459.1.70792 WP_001044459.1.70797 WP_001044459.1.70837 WP_001044459.1.70899 WP_001044459.1.70929 WP_001044459.1.70959 WP_001044459.1.70969 WP_001044459.1.70977 WP_001044459.1.70985 WP_001044459.1.71023 WP_001044459.1.7110 WP_001044459.1.71172 WP_001044459.1.71184 WP_001044459.1.71201 WP_001044459.1.71268 WP_001044459.1.71305 WP_001044459.1.71363 WP_001044459.1.714 WP_001044459.1.71407 WP_001044459.1.71418 WP_001044459.1.71452 WP_001044459.1.71600 WP_001044459.1.71626 WP_001044459.1.71636 WP_001044459.1.71649 WP_001044459.1.71798 WP_001044459.1.71923 WP_001044459.1.71979 WP_001044459.1.71984 WP_001044459.1.720 WP_001044459.1.72065 WP_001044459.1.72100 WP_001044459.1.72182 WP_001044459.1.72190 WP_001044459.1.72220 WP_001044459.1.72221 WP_001044459.1.72243 WP_001044459.1.72283 WP_001044459.1.72300 WP_001044459.1.72307 WP_001044459.1.72325 WP_001044459.1.72339 WP_001044459.1.72403 WP_001044459.1.7243 WP_001044459.1.72470 WP_001044459.1.72532 WP_001044459.1.72602 WP_001044459.1.72625 WP_001044459.1.72689 WP_001044459.1.72716 WP_001044459.1.72718 WP_001044459.1.72728 WP_001044459.1.72793 WP_001044459.1.72850 WP_001044459.1.72865 WP_001044459.1.72872 WP_001044459.1.72892 WP_001044459.1.72944 WP_001044459.1.7295 WP_001044459.1.72968 WP_001044459.1.73068 WP_001044459.1.73125 WP_001044459.1.73144 WP_001044459.1.73164 WP_001044459.1.73328 WP_001044459.1.73461 WP_001044459.1.73512 WP_001044459.1.73596 WP_001044459.1.73708 WP_001044459.1.7374 WP_001044459.1.73764 WP_001044459.1.73847 WP_001044459.1.7386 WP_001044459.1.7394 WP_001044459.1.74028 WP_001044459.1.74089 WP_001044459.1.74174 WP_001044459.1.74207 WP_001044459.1.74248 WP_001044459.1.743 WP_001044459.1.74300 WP_001044459.1.74402 WP_001044459.1.74418 WP_001044459.1.7444 WP_001044459.1.74454 WP_001044459.1.745 WP_001044459.1.74570 WP_001044459.1.74578 WP_001044459.1.74620 WP_001044459.1.74807 WP_001044459.1.74826 WP_001044459.1.74884 WP_001044459.1.7491 WP_001044459.1.74946 WP_001044459.1.74972 WP_001044459.1.74996 WP_001044459.1.75051 WP_001044459.1.75056 WP_001044459.1.75114 WP_001044459.1.75148 WP_001044459.1.75159 WP_001044459.1.75301 WP_001044459.1.75400 WP_001044459.1.75450 WP_001044459.1.7558 WP_001044459.1.75607 WP_001044459.1.75716 WP_001044459.1.75740 WP_001044459.1.75751 WP_001044459.1.75793 WP_001044459.1.75794 WP_001044459.1.75810 WP_001044459.1.75863 WP_001044459.1.75902 WP_001044459.1.75932 WP_001044459.1.76 WP_001044459.1.76102 WP_001044459.1.76108 WP_001044459.1.76137 WP_001044459.1.76162 WP_001044459.1.76164 WP_001044459.1.76170 WP_001044459.1.76208 WP_001044459.1.76327 WP_001044459.1.76345 WP_001044459.1.76434 WP_001044459.1.76451 WP_001044459.1.76471 WP_001044459.1.76495 WP_001044459.1.7672 WP_001044459.1.76738 WP_001044459.1.76776 WP_001044459.1.76799 WP_001044459.1.7684 WP_001044459.1.76913 WP_001044459.1.76968 WP_001044459.1.77067 WP_001044459.1.77177 WP_001044459.1.77184 WP_001044459.1.77241 WP_001044459.1.77267 WP_001044459.1.77306 WP_001044459.1.77356 WP_001044459.1.77431 WP_001044459.1.77440 WP_001044459.1.77475 WP_001044459.1.77496 WP_001044459.1.77543 WP_001044459.1.77555 WP_001044459.1.77565 WP_001044459.1.77629 WP_001044459.1.77710 WP_001044459.1.7792 WP_001044459.1.7793 WP_001044459.1.77951 WP_001044459.1.77983 WP_001044459.1.77989 WP_001044459.1.7802 WP_001044459.1.78051 WP_001044459.1.78053 WP_001044459.1.7814 WP_001044459.1.78168 WP_001044459.1.78170 WP_001044459.1.78259 WP_001044459.1.78372 WP_001044459.1.78501 WP_001044459.1.78602 WP_001044459.1.78603 WP_001044459.1.78632 WP_001044459.1.78658 WP_001044459.1.78697 WP_001044459.1.78734 WP_001044459.1.7877 WP_001044459.1.78815 WP_001044459.1.78838 WP_001044459.1.78877 WP_001044459.1.78881 WP_001044459.1.78896 WP_001044459.1.78913 WP_001044459.1.78928 WP_001044459.1.79081 WP_001044459.1.79099 WP_001044459.1.79140 WP_001044459.1.79289 WP_001044459.1.79370 WP_001044459.1.79466 WP_001044459.1.79468 WP_001044459.1.79580 WP_001044459.1.79586 WP_001044459.1.79645 WP_001044459.1.7972 WP_001044459.1.79734 WP_001044459.1.79757 WP_001044459.1.7979 WP_001044459.1.7982 WP_001044459.1.7991 WP_001044459.1.79945 WP_001044459.1.79951 WP_001044459.1.79974 WP_001044459.1.80249 WP_001044459.1.80250 WP_001044459.1.80254 WP_001044459.1.80293 WP_001044459.1.80380 WP_001044459.1.80441 WP_001044459.1.80443 WP_001044459.1.80473 WP_001044459.1.80542 WP_001044459.1.80586 WP_001044459.1.80609 WP_001044459.1.80638 WP_001044459.1.80725 WP_001044459.1.80741 WP_001044459.1.80760 WP_001044459.1.80819 WP_001044459.1.80874 WP_001044459.1.80876 WP_001044459.1.80927 WP_001044459.1.80973 WP_001044459.1.8106 WP_001044459.1.81067 WP_001044459.1.81107 WP_001044459.1.81109 WP_001044459.1.81110 WP_001044459.1.81197 WP_001044459.1.81225 WP_001044459.1.81231 WP_001044459.1.8130 WP_001044459.1.81302 WP_001044459.1.81305 WP_001044459.1.81320 WP_001044459.1.81328 WP_001044459.1.8134 WP_001044459.1.81388 WP_001044459.1.81409 WP_001044459.1.81455 WP_001044459.1.81528 WP_001044459.1.81548 WP_001044459.1.81667 WP_001044459.1.81668 WP_001044459.1.8168 WP_001044459.1.81727 WP_001044459.1.81735 WP_001044459.1.81736 WP_001044459.1.81746 WP_001044459.1.81768 WP_001044459.1.81795 WP_001044459.1.8196 WP_001044459.1.81977 WP_001044459.1.82141 WP_001044459.1.82149 WP_001044459.1.82192 WP_001044459.1.82232 WP_001044459.1.82258 WP_001044459.1.82347 WP_001044459.1.8236 WP_001044459.1.82369 WP_001044459.1.82401 WP_001044459.1.82420 WP_001044459.1.82434 WP_001044459.1.82464 WP_001044459.1.8247 WP_001044459.1.82474 WP_001044459.1.82569 WP_001044459.1.82636 WP_001044459.1.82895 WP_001044459.1.82908 WP_001044459.1.82937 WP_001044459.1.83006 WP_001044459.1.83061 WP_001044459.1.83204 WP_001044459.1.83221 WP_001044459.1.83252 WP_001044459.1.83258 WP_001044459.1.83331 WP_001044459.1.83354 WP_001044459.1.83356 WP_001044459.1.83382 WP_001044459.1.83407 WP_001044459.1.83558 WP_001044459.1.83739 WP_001044459.1.83759 WP_001044459.1.83979 WP_001044459.1.8399 WP_001044459.1.84000 WP_001044459.1.84001 WP_001044459.1.84011 WP_001044459.1.84075 WP_001044459.1.84083 WP_001044459.1.84086 WP_001044459.1.84100 WP_001044459.1.84106 WP_001044459.1.84154 WP_001044459.1.84209 WP_001044459.1.8425 WP_001044459.1.84291 WP_001044459.1.84300 WP_001044459.1.84397 WP_001044459.1.84497 WP_001044459.1.84515 WP_001044459.1.84551 WP_001044459.1.84572 WP_001044459.1.84598 WP_001044459.1.84876 WP_001044459.1.84983 WP_001044459.1.85079 WP_001044459.1.85094 WP_001044459.1.85126 WP_001044459.1.85217 WP_001044459.1.8526 WP_001044459.1.85271 WP_001044459.1.85301 WP_001044459.1.85408 WP_001044459.1.85433 WP_001044459.1.8552 WP_001044459.1.85568 WP_001044459.1.85759 WP_001044459.1.85784 WP_001044459.1.85854 WP_001044459.1.85864 WP_001044459.1.85982 WP_001044459.1.86043 WP_001044459.1.86120 WP_001044459.1.86138 WP_001044459.1.86157 WP_001044459.1.86159 WP_001044459.1.8616 WP_001044459.1.86173 WP_001044459.1.86240 WP_001044459.1.86259 WP_001044459.1.86284 WP_001044459.1.86316 WP_001044459.1.86347 WP_001044459.1.86380 WP_001044459.1.8647 WP_001044459.1.86514 WP_001044459.1.86610 WP_001044459.1.86656 WP_001044459.1.86699 WP_001044459.1.8671 WP_001044459.1.86744 WP_001044459.1.86902 WP_001044459.1.8691 WP_001044459.1.86915 WP_001044459.1.86982 WP_001044459.1.87038 WP_001044459.1.87143 WP_001044459.1.87187 WP_001044459.1.87219 WP_001044459.1.87265 WP_001044459.1.87282 WP_001044459.1.87283 WP_001044459.1.87484 WP_001044459.1.87493 WP_001044459.1.87500 WP_001044459.1.87583 WP_001044459.1.87584 WP_001044459.1.87626 WP_001044459.1.8767 WP_001044459.1.87687 WP_001044459.1.87695 WP_001044459.1.87712 WP_001044459.1.87760 WP_001044459.1.87899 WP_001044459.1.87905 WP_001044459.1.8792 WP_001044459.1.87933 WP_001044459.1.87936 WP_001044459.1.88014 WP_001044459.1.88052 WP_001044459.1.88092 WP_001044459.1.88185 WP_001044459.1.88214 WP_001044459.1.88275 WP_001044459.1.88303 WP_001044459.1.88356 WP_001044459.1.88474 WP_001044459.1.88508 WP_001044459.1.88609 WP_001044459.1.88620 WP_001044459.1.88624 WP_001044459.1.88651 WP_001044459.1.88683 WP_001044459.1.88731 WP_001044459.1.88762 WP_001044459.1.88854 WP_001044459.1.88957 WP_001044459.1.88966 WP_001044459.1.88968 WP_001044459.1.88970 WP_001044459.1.88980 WP_001044459.1.88982 WP_001044459.1.88998 WP_001044459.1.89114 WP_001044459.1.89119 WP_001044459.1.89120 WP_001044459.1.89174 WP_001044459.1.89177 WP_001044459.1.89221 WP_001044459.1.89311 WP_001044459.1.89362 WP_001044459.1.89408 WP_001044459.1.89425 WP_001044459.1.8958 WP_001044459.1.89580 WP_001044459.1.89606 WP_001044459.1.8961 WP_001044459.1.89634 WP_001044459.1.89647 WP_001044459.1.89657 WP_001044459.1.89680 WP_001044459.1.89765 WP_001044459.1.89777 WP_001044459.1.89815 WP_001044459.1.89817 WP_001044459.1.89832 WP_001044459.1.89940 WP_001044459.1.9003 WP_001044459.1.90348 WP_001044459.1.90421 WP_001044459.1.90472 WP_001044459.1.90522 WP_001044459.1.90540 WP_001044459.1.90563 WP_001044459.1.90620 WP_001044459.1.90701 WP_001044459.1.90748 WP_001044459.1.90759 WP_001044459.1.90792 WP_001044459.1.90859 WP_001044459.1.90866 WP_001044459.1.90876 WP_001044459.1.90959 WP_001044459.1.90973 WP_001044459.1.91042 WP_001044459.1.91056 WP_001044459.1.91179 WP_001044459.1.91215 WP_001044459.1.9137 WP_001044459.1.91372 WP_001044459.1.91424 WP_001044459.1.91474 WP_001044459.1.91493 WP_001044459.1.91505 WP_001044459.1.91580 WP_001044459.1.91621 WP_001044459.1.91702 WP_001044459.1.91736 WP_001044459.1.91742 WP_001044459.1.91772 WP_001044459.1.91776 WP_001044459.1.91795 WP_001044459.1.91864 WP_001044459.1.91880 WP_001044459.1.91898 WP_001044459.1.91903 WP_001044459.1.91904 WP_001044459.1.91974 WP_001044459.1.92047 WP_001044459.1.92067 WP_001044459.1.92082 WP_001044459.1.92099 WP_001044459.1.92129 WP_001044459.1.92165 WP_001044459.1.9222 WP_001044459.1.92394 WP_001044459.1.92439 WP_001044459.1.92452 WP_001044459.1.92529 WP_001044459.1.92557 WP_001044459.1.92628 WP_001044459.1.92659 WP_001044459.1.92754 WP_001044459.1.92806 WP_001044459.1.92827 WP_001044459.1.92890 WP_001044459.1.92893 WP_001044459.1.92926 WP_001044459.1.92929 WP_001044459.1.93059 WP_001044459.1.93061 WP_001044459.1.93076 WP_001044459.1.93215 WP_001044459.1.93339 WP_001044459.1.93350 WP_001044459.1.93410 WP_001044459.1.93524 WP_001044459.1.93577 WP_001044459.1.93596 WP_001044459.1.93604 WP_001044459.1.93761 WP_001044459.1.9380 WP_001044459.1.93803 WP_001044459.1.93809 WP_001044459.1.93837 WP_001044459.1.93937 WP_001044459.1.94070 WP_001044459.1.94383 WP_001044459.1.9440 WP_001044459.1.94412 WP_001044459.1.94473 WP_001044459.1.94598 WP_001044459.1.94649 WP_001044459.1.94655 WP_001044459.1.94670 WP_001044459.1.94717 WP_001044459.1.94817 WP_001044459.1.94835 WP_001044459.1.94849 WP_001044459.1.94862 WP_001044459.1.94967 WP_001044459.1.94983 WP_001044459.1.94987 WP_001044459.1.95094 WP_001044459.1.95136 WP_001044459.1.9516 WP_001044459.1.95235 WP_001044459.1.95248 WP_001044459.1.9527 WP_001044459.1.95277 WP_001044459.1.9530 WP_001044459.1.95320 WP_001044459.1.95388 WP_001044459.1.95434 WP_001044459.1.95447 WP_001044459.1.95456 WP_001044459.1.95558 WP_001044459.1.95579 WP_001044459.1.95607 WP_001044459.1.95623 WP_001044459.1.95656 WP_001044459.1.95670 WP_001044459.1.95691 WP_001044459.1.95729 WP_001044459.1.95744 WP_001044459.1.95757 WP_001044459.1.95805 WP_001044459.1.9586 WP_001044459.1.95866 WP_001044459.1.95939 WP_001044459.1.95963 WP_001044459.1.96004 WP_001044459.1.96042 WP_001044459.1.96107 WP_001044459.1.96162 WP_001044459.1.96190 WP_001044459.1.9624 WP_001044459.1.96340 WP_001044459.1.96348 WP_001044459.1.96349 WP_001044459.1.96380 WP_001044459.1.96490 WP_001044459.1.96521 WP_001044459.1.96537 WP_001044459.1.96584 WP_001044459.1.96588 WP_001044459.1.96640 WP_001044459.1.96642 WP_001044459.1.96662 WP_001044459.1.96735 WP_001044459.1.9674 WP_001044459.1.96761 WP_001044459.1.96798 WP_001044459.1.9686 WP_001044459.1.96876 WP_001044459.1.96993 WP_001044459.1.97047 WP_001044459.1.97103 WP_001044459.1.97143 WP_001044459.1.97297 WP_001044459.1.97322 WP_001044459.1.97328 WP_001044459.1.97477 WP_001044459.1.97487 WP_001044459.1.97534 WP_001044459.1.97547 WP_001044459.1.97626 WP_001044459.1.97628 WP_001044459.1.97631 WP_001044459.1.97648 WP_001044459.1.97656 WP_001044459.1.97691 WP_001044459.1.97693 WP_001044459.1.97704 WP_001044459.1.9774 WP_001044459.1.97768 WP_001044459.1.97800 WP_001044459.1.97873 WP_001044459.1.97907 WP_001044459.1.9793 WP_001044459.1.97981 WP_001044459.1.9799 WP_001044459.1.97991 WP_001044459.1.9805 WP_001044459.1.98119 WP_001044459.1.98170 WP_001044459.1.98250 WP_001044459.1.9826 WP_001044459.1.98338 WP_001044459.1.98392 WP_001044459.1.98402 WP_001044459.1.98440 WP_001044459.1.98472 WP_001044459.1.98483 WP_001044459.1.98513 WP_001044459.1.98570 WP_001044459.1.9863 WP_001044459.1.98726 WP_001044459.1.98763 WP_001044459.1.98931 WP_001044459.1.9899 WP_001044459.1.99057 WP_001044459.1.99097 WP_001044459.1.99107 WP_001044459.1.99164 WP_001044459.1.99215 WP_001044459.1.99219 WP_001044459.1.99255 WP_001044459.1.99278 WP_001044459.1.99327 WP_001044459.1.99370 WP_001044459.1.99426 WP_001044459.1.99456 WP_001044459.1.99490 WP_001044459.1.99493 WP_001044459.1.99577 WP_001044459.1.99613 WP_001044459.1.99626 WP_001044459.1.99630 WP_001044459.1.99725 WP_001044459.1.99824 WP_001044459.1.99924 WP_001044459.1.99961 gi|525858729|ref|YP_008262093.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]