SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62183009|ref|YP_219426.1| from Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62183009|ref|YP_219426.1|
Domain Number 1 Region: 16-139
Classification Level Classification E-value
Superfamily PapD-like 1.94e-38
Family Pilus chaperone 0.00021
Further Details:      
 
Domain Number 2 Region: 133-221
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 1.26e-21
Family Periplasmic chaperone C-domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62183009|ref|YP_219426.1|
Sequence length 227
Comment fimbrial chaperone protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
Sequence
MKHIKKSVLVVLLTSHVAHASIVVGGTRLVFDGNNDESSINVENKDSKANLVQSWLSVAD
PQVTNKQAFIITPPLFRLDAGQKNSIRVIRSGAPLPADRESMYWLNIKGIPSIDDNASAN
RVEISINTQIKLIYRPPALTKSTPDSQSQQLKWQTAGDVITVNNPTPYYMNFASVTLNSH
EVKSATFVPPKSSASFKLSSTAAPHGTVTWRLISDYGMSLEPHSGSF
Download sequence
Identical sequences A0A1J4RBR2 A0A1S0ZDX1 A0A1Z3QBS1 A0A221Z4H8 A0A2J5XLM9 Q57G17
gi|549481661|ref|YP_008616186.1| 321314.SC4439 AE017220|CDS_4751046-4750363 gi|62183009|ref|YP_219426.1| WP_000680523.1.100266 WP_000680523.1.100584 WP_000680523.1.100642 WP_000680523.1.100707 WP_000680523.1.100750 WP_000680523.1.100814 WP_000680523.1.101223 WP_000680523.1.101724 WP_000680523.1.101868 WP_000680523.1.10310 WP_000680523.1.11041 WP_000680523.1.113 WP_000680523.1.11304 WP_000680523.1.11511 WP_000680523.1.12144 WP_000680523.1.13677 WP_000680523.1.13691 WP_000680523.1.14011 WP_000680523.1.14688 WP_000680523.1.14927 WP_000680523.1.15468 WP_000680523.1.15612 WP_000680523.1.15637 WP_000680523.1.15795 WP_000680523.1.1601 WP_000680523.1.16032 WP_000680523.1.16201 WP_000680523.1.17758 WP_000680523.1.17919 WP_000680523.1.18089 WP_000680523.1.1814 WP_000680523.1.18489 WP_000680523.1.18895 WP_000680523.1.19240 WP_000680523.1.19340 WP_000680523.1.1990 WP_000680523.1.19970 WP_000680523.1.20364 WP_000680523.1.20700 WP_000680523.1.20789 WP_000680523.1.21181 WP_000680523.1.22270 WP_000680523.1.22337 WP_000680523.1.22845 WP_000680523.1.22855 WP_000680523.1.23148 WP_000680523.1.23309 WP_000680523.1.23409 WP_000680523.1.23670 WP_000680523.1.2376 WP_000680523.1.23819 WP_000680523.1.24303 WP_000680523.1.24392 WP_000680523.1.24444 WP_000680523.1.24727 WP_000680523.1.25072 WP_000680523.1.25229 WP_000680523.1.25596 WP_000680523.1.25700 WP_000680523.1.25932 WP_000680523.1.27169 WP_000680523.1.27342 WP_000680523.1.27513 WP_000680523.1.27616 WP_000680523.1.2825 WP_000680523.1.287 WP_000680523.1.28902 WP_000680523.1.29265 WP_000680523.1.3017 WP_000680523.1.30213 WP_000680523.1.30389 WP_000680523.1.30437 WP_000680523.1.30602 WP_000680523.1.3089 WP_000680523.1.3124 WP_000680523.1.31262 WP_000680523.1.3127 WP_000680523.1.31845 WP_000680523.1.32038 WP_000680523.1.32054 WP_000680523.1.32459 WP_000680523.1.32493 WP_000680523.1.32902 WP_000680523.1.32961 WP_000680523.1.33160 WP_000680523.1.34107 WP_000680523.1.34647 WP_000680523.1.34745 WP_000680523.1.3476 WP_000680523.1.35125 WP_000680523.1.35294 WP_000680523.1.35777 WP_000680523.1.36236 WP_000680523.1.36425 WP_000680523.1.36542 WP_000680523.1.36564 WP_000680523.1.36792 WP_000680523.1.36948 WP_000680523.1.36978 WP_000680523.1.37190 WP_000680523.1.37320 WP_000680523.1.37363 WP_000680523.1.37666 WP_000680523.1.38740 WP_000680523.1.38857 WP_000680523.1.38881 WP_000680523.1.38895 WP_000680523.1.39183 WP_000680523.1.40008 WP_000680523.1.40771 WP_000680523.1.40788 WP_000680523.1.4088 WP_000680523.1.41345 WP_000680523.1.42238 WP_000680523.1.43763 WP_000680523.1.4422 WP_000680523.1.44250 WP_000680523.1.4440 WP_000680523.1.44593 WP_000680523.1.44702 WP_000680523.1.44943 WP_000680523.1.44985 WP_000680523.1.45027 WP_000680523.1.45251 WP_000680523.1.45268 WP_000680523.1.45522 WP_000680523.1.45535 WP_000680523.1.45566 WP_000680523.1.46203 WP_000680523.1.46232 WP_000680523.1.46693 WP_000680523.1.47005 WP_000680523.1.47014 WP_000680523.1.47817 WP_000680523.1.49626 WP_000680523.1.49827 WP_000680523.1.50285 WP_000680523.1.50480 WP_000680523.1.50497 WP_000680523.1.50777 WP_000680523.1.50800 WP_000680523.1.51900 WP_000680523.1.52675 WP_000680523.1.5273 WP_000680523.1.52748 WP_000680523.1.5301 WP_000680523.1.5316 WP_000680523.1.53274 WP_000680523.1.53675 WP_000680523.1.54827 WP_000680523.1.5527 WP_000680523.1.55477 WP_000680523.1.55496 WP_000680523.1.55623 WP_000680523.1.55718 WP_000680523.1.56059 WP_000680523.1.56097 WP_000680523.1.56303 WP_000680523.1.56368 WP_000680523.1.56370 WP_000680523.1.56512 WP_000680523.1.57710 WP_000680523.1.57857 WP_000680523.1.57902 WP_000680523.1.58157 WP_000680523.1.59012 WP_000680523.1.59097 WP_000680523.1.59486 WP_000680523.1.59512 WP_000680523.1.59562 WP_000680523.1.59587 WP_000680523.1.59604 WP_000680523.1.59755 WP_000680523.1.60106 WP_000680523.1.60226 WP_000680523.1.60486 WP_000680523.1.60608 WP_000680523.1.6090 WP_000680523.1.6108 WP_000680523.1.61200 WP_000680523.1.61434 WP_000680523.1.61497 WP_000680523.1.61509 WP_000680523.1.61922 WP_000680523.1.62142 WP_000680523.1.62219 WP_000680523.1.62222 WP_000680523.1.62241 WP_000680523.1.62798 WP_000680523.1.63118 WP_000680523.1.63135 WP_000680523.1.63532 WP_000680523.1.63633 WP_000680523.1.63781 WP_000680523.1.64294 WP_000680523.1.64374 WP_000680523.1.64389 WP_000680523.1.64771 WP_000680523.1.64919 WP_000680523.1.65185 WP_000680523.1.65363 WP_000680523.1.65687 WP_000680523.1.65876 WP_000680523.1.66272 WP_000680523.1.66492 WP_000680523.1.67603 WP_000680523.1.68036 WP_000680523.1.68075 WP_000680523.1.6858 WP_000680523.1.68690 WP_000680523.1.68958 WP_000680523.1.6907 WP_000680523.1.69296 WP_000680523.1.69346 WP_000680523.1.69817 WP_000680523.1.70685 WP_000680523.1.7134 WP_000680523.1.71407 WP_000680523.1.71418 WP_000680523.1.72107 WP_000680523.1.72220 WP_000680523.1.72351 WP_000680523.1.72671 WP_000680523.1.72892 WP_000680523.1.72968 WP_000680523.1.7316 WP_000680523.1.73164 WP_000680523.1.73596 WP_000680523.1.7386 WP_000680523.1.73901 WP_000680523.1.7394 WP_000680523.1.74049 WP_000680523.1.74418 WP_000680523.1.7444 WP_000680523.1.74639 WP_000680523.1.74884 WP_000680523.1.75134 WP_000680523.1.75180 WP_000680523.1.75932 WP_000680523.1.76162 WP_000680523.1.76434 WP_000680523.1.77184 WP_000680523.1.77436 WP_000680523.1.77754 WP_000680523.1.78170 WP_000680523.1.78180 WP_000680523.1.79370 WP_000680523.1.79645 WP_000680523.1.79914 WP_000680523.1.80229 WP_000680523.1.80443 WP_000680523.1.80479 WP_000680523.1.80542 WP_000680523.1.80707 WP_000680523.1.80723 WP_000680523.1.80973 WP_000680523.1.8127 WP_000680523.1.81795 WP_000680523.1.8196 WP_000680523.1.81977 WP_000680523.1.82144 WP_000680523.1.82908 WP_000680523.1.83407 WP_000680523.1.83516 WP_000680523.1.83739 WP_000680523.1.84001 WP_000680523.1.84100 WP_000680523.1.84721 WP_000680523.1.85654 WP_000680523.1.85742 WP_000680523.1.85797 WP_000680523.1.85943 WP_000680523.1.86126 WP_000680523.1.86206 WP_000680523.1.86389 WP_000680523.1.86442 WP_000680523.1.86676 WP_000680523.1.86807 WP_000680523.1.86860 WP_000680523.1.87219 WP_000680523.1.87493 WP_000680523.1.88597 WP_000680523.1.88624 WP_000680523.1.88651 WP_000680523.1.88675 WP_000680523.1.88698 WP_000680523.1.89632 WP_000680523.1.89815 WP_000680523.1.89914 WP_000680523.1.89940 WP_000680523.1.90566 WP_000680523.1.91580 WP_000680523.1.91914 WP_000680523.1.9253 WP_000680523.1.92883 WP_000680523.1.93061 WP_000680523.1.93648 WP_000680523.1.93767 WP_000680523.1.93803 WP_000680523.1.94039 WP_000680523.1.94412 WP_000680523.1.94588 WP_000680523.1.9463 WP_000680523.1.94982 WP_000680523.1.95320 WP_000680523.1.95744 WP_000680523.1.95803 WP_000680523.1.9627 WP_000680523.1.97480 WP_000680523.1.97626 WP_000680523.1.97873 WP_000680523.1.98402 WP_000680523.1.98763 WP_000680523.1.99198 WP_000680523.1.99426 WP_000680523.1.99824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]