SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62180736|ref|YP_217153.1| from Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62180736|ref|YP_217153.1|
Domain Number 1 Region: 38-163
Classification Level Classification E-value
Superfamily PapD-like 5.76e-38
Family Pilus chaperone 0.00044
Further Details:      
 
Domain Number 2 Region: 159-248
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.0000000000000118
Family Periplasmic chaperone C-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62180736|ref|YP_217153.1|
Sequence length 250
Comment periplasmic chaperone protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
Sequence
MLLTNLFNRRRSSPVFYKQGRVNMKILSAVLLSAIILPAHAGIVIYGTRVIYPAEKKEVV
VQLVNQGEQASLVQSWIDDGNTSLPPEKIQVPFMLTPPVARVAAESGQQLKIKKMPNSLP
DNKESLFYLNVLDIPPNSQENAGKNVLKFTMQNRIKLIWRPSRIAAVTKDSFQRIGLFRS
NKTVIMKNDTANWITVTDVKAGNTKINDQTIMLPPLSTQNINMKYASTSQYEVTIIDDNG
NYISSKINVK
Download sequence
Identical sequences Q57MI9
AE017220|CDS_2269627-2268875 321314.SC2166 WP_001540416.1.22270 WP_001540416.1.32493 WP_001540416.1.36948 WP_001540416.1.44943 WP_001540416.1.50777 WP_001540416.1.57902 WP_001540416.1.60486 WP_001540416.1.76162 gi|62180736|ref|YP_217153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]