SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conco1|11578|gm1.9818_g from Conidiobolus coronatus NRRL28638 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conco1|11578|gm1.9818_g
Domain Number 1 Region: 3-114
Classification Level Classification E-value
Superfamily DOPA-like 8.63e-37
Family DOPA dioxygenase-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conco1|11578|gm1.9818_g
Sequence length 131
Sequence
MSFPNPIELFDVHVYFLQDNPGSVKSAEHLRQKIIDKFPHLTVYNMVHRPIGPHPTAMFE
LKLKNNAEFGEFFPWLVLNRGPHSVLVHPQTGDDFIDHAQYASWLGQPLPLDMTMQNRWP
NDLYPPHVELK
Download sequence
Identical sequences A0A137NUW2
jgi|Conco1|11578|gm1.9818_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]