SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Conco1|13035|gm1.11275_g from Conidiobolus coronatus NRRL28638 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conco1|13035|gm1.11275_g
Domain Number 1 Region: 55-95
Classification Level Classification E-value
Superfamily Hypothetical protein YjbJ 0.0000222
Family Hypothetical protein YjbJ 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Conco1|13035|gm1.11275_g
Domain Number - Region: 6-53
Classification Level Classification E-value
Superfamily Hypothetical protein YjbJ 0.000222
Family Hypothetical protein YjbJ 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conco1|13035|gm1.11275_g
Sequence length 99
Sequence
MSYDPSKTNANYNKGMGSVKEGLGSALGNKEMQAKGNVQNQQGHGEQKAAETKGWVQGAM
DTVTGTVKDMAGSVTGNTGKQAEGKAQKAQGDYRKGINA
Download sequence
Identical sequences A0A137NRR4
jgi|Conco1|13035|gm1.11275_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]